mRNA_M-pyrifera_M_contig88307.20508.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A6H5KS52_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KS52_9PHAE) HSP 1 Score: 99.8 bits (247), Expect = 3.470e-23 Identity = 42/49 (85.71%), Postives = 46/49 (93.88%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTRG 150 RLRILA VGMYAARAWD+HDLLHQC+EVERD+HWWHVLTSLG+ FD RG Sbjct: 432 RLRILAGVGMYAARAWDNHDLLHQCMEVERDSHWWHVLTSLGITFDNRG 480
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: D8LSU3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSU3_ECTSI) HSP 1 Score: 99.4 bits (246), Expect = 4.730e-23 Identity = 41/49 (83.67%), Postives = 46/49 (93.88%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTRG 150 RLR+LA VGMYAARAWD+HDLLHQC+EVERD+HWWHVLTSLG+ FD RG Sbjct: 1871 RLRVLAGVGMYAARAWDNHDLLHQCMEVERDSHWWHVLTSLGIAFDNRG 1919
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A0N7L774_PLAHL (Kinetochore component n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0N7L774_PLAHL) HSP 1 Score: 58.2 bits (139), Expect = 1.500e-8 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LA +G AARAW LHQC+E+E +A WWH LT LG+ D + Sbjct: 1460 RFQHLALIGADAARAWQQIAFLHQCVELEENARWWHYLTLLGIECDHK 1507
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A2D4CBX0_PYTIN (Rod_C domain-containing protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CBX0_PYTIN) HSP 1 Score: 57.8 bits (138), Expect = 2.040e-8 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LAR+G AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 125 RFQQLARIGADAARAWQQIAFLHQCVELEGNARWWHYLKLLGIQCDHK 172
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A6A3NKS0_9STRA (Rod_C domain-containing protein n=6 Tax=Phytophthora TaxID=4783 RepID=A0A6A3NKS0_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 3.820e-8 Identity = 23/48 (47.92%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LA +G AARAW + LHQC+E+E +A WWH L LG+ D + Sbjct: 1486 RFQQLAHIGADAARAWQEIAFLHQCVELEGNARWWHYLNLLGIECDHK 1533
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: D0NTT7_PHYIT (Rod_C domain-containing protein n=1 Tax=Phytophthora infestans (strain T30-4) TaxID=403677 RepID=D0NTT7_PHYIT) HSP 1 Score: 55.8 bits (133), Expect = 9.770e-8 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LA VG AARAW LHQC+E+E +A WWH L+ LG+ D + Sbjct: 623 RFQKLAFVGADAARAWQQIAFLHQCVELEGNARWWHYLSLLGIECDHK 670
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A833VZF6_PHYIN (Rough deal protein C-terminal region n=1 Tax=Phytophthora infestans TaxID=4787 RepID=A0A833VZF6_PHYIN) HSP 1 Score: 55.8 bits (133), Expect = 9.780e-8 Identity = 24/48 (50.00%), Postives = 31/48 (64.58%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LA VG AARAW LHQC+E+E +A WWH L+ LG+ D + Sbjct: 1272 RFQKLAFVGADAARAWQQIAFLHQCVELEGNARWWHYLSLLGIECDHK 1319
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: G4Z2Z9_PHYSP (Rod_C domain-containing protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4Z2Z9_PHYSP) HSP 1 Score: 55.5 bits (132), Expect = 1.340e-7 Identity = 24/48 (50.00%), Postives = 30/48 (62.50%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LA VG AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 655 RFQQLAFVGADAARAWQQIAFLHQCVELEGNARWWHYLNLLGIECDHK 702
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A0W8DCK1_PHYNI (Uncharacterized protein n=1 Tax=Phytophthora nicotianae TaxID=4790 RepID=A0A0W8DCK1_PHYNI) HSP 1 Score: 55.1 bits (131), Expect = 1.820e-7 Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LA +G AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 692 RFQKLAFIGADAARAWQQIAFLHQCVELEGNARWWHYLNLLGIECDHK 739
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Match: A0A225V152_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Phytophthora megakarya TaxID=4795 RepID=A0A225V152_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 1.820e-7 Identity = 23/48 (47.92%), Postives = 30/48 (62.50%), Query Frame = 1 Query: 4 RLRILARVGMYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTR 147 R + LA +G AARAW LHQC+E+E +A WWH L LG+ D + Sbjct: 756 RFQRLACIGADAARAWQQIAFLHQCVELEGNARWWHYLNLLGIECDHK 803 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig88307.20508.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 13
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig88307.20508.1 >prot_M-pyrifera_M_contig88307.20508.1 ID=prot_M-pyrifera_M_contig88307.20508.1|Name=mRNA_M-pyrifera_M_contig88307.20508.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=41bp MYAARAWDDHDLLHQCIEVERDAHWWHVLTSLGVPFDTRG*back to top mRNA from alignment at M-pyrifera_M_contig88307:342..494+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig88307.20508.1 ID=mRNA_M-pyrifera_M_contig88307.20508.1|Name=mRNA_M-pyrifera_M_contig88307.20508.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=153bp|location=Sequence derived from alignment at M-pyrifera_M_contig88307:342..494+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig88307:342..494+ >mRNA_M-pyrifera_M_contig88307.20508.1 ID=mRNA_M-pyrifera_M_contig88307.20508.1|Name=mRNA_M-pyrifera_M_contig88307.20508.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=246bp|location=Sequence derived from alignment at M-pyrifera_M_contig88307:342..494+ (Macrocystis pyrifera P11B4 male)back to top |