prot_M-pyrifera_M_contig86005.20045.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig86005.20045.1 vs. uniprot
Match: A0A6P8QL54_GEOSA (VPS9 domain-containing protein 1 isoform X1 n=3 Tax=Geotrypetes seraphini TaxID=260995 RepID=A0A6P8QL54_GEOSA) HSP 1 Score: 63.5 bits (153), Expect = 1.490e-9 Identity = 31/106 (29.25%), Postives = 60/106 (56.60%), Query Frame = 0 Query: 1 YAKALGIFRTLLLQRTPRQKCATVAKALQAVCDAPLDHYRG---RLPPRKATMGTDELVDAFAFIVVQSHVTSLISQLGFIETFLPARLRIGADGFAVTNLHTAVS 103 Y A+ R L L++ P++K + K L+ +C+ ++ + P A +G D+L+ +FIV++S + L+S+ +E F+ IGA+G+ +T+L +A+S Sbjct: 567 YKAAVEELRLLTLEQCPQKKLECIVKTLRVICECAEEYSNTEELKAQPNSAAIGADDLLPILSFIVLRSDLPQLVSECAALEEFIHEGYLIGAEGYCLTSLQSALS 672
BLAST of mRNA_M-pyrifera_M_contig86005.20045.1 vs. uniprot
Match: A0A024U504_9STRA (VPS9 domain-containing protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024U504_9STRA) HSP 1 Score: 57.8 bits (138), Expect = 1.520e-7 Identity = 33/106 (31.13%), Postives = 53/106 (50.00%), Query Frame = 0 Query: 1 YAKALGIFRTLLLQRTPRQKCATVAKALQAVCDAPLDHYRGRLPP---RKATMGTDELVDAFAFIVVQSHVTSLISQLGFIETFLPARLRIGADGFAVTNLHTAVS 103 Y + L QR+P K A V++ + + +Y G P + + D LV A++VV ++ L S L ++ FLP R+ IG + +AVT LHTA++ Sbjct: 314 YTNCITKMSELPHQRSPSAKVAVVSQVCRLIDVTIHTYYAGHPNPPPVEQLHIAADALVSVLAYVVVMANCPHLASHLALMDAFLPDRISIGEEAYAVTILHTAIA 419 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig86005.20045.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig86005.20045.1 ID=prot_M-pyrifera_M_contig86005.20045.1|Name=mRNA_M-pyrifera_M_contig86005.20045.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=103bpback to top |