prot_M-pyrifera_M_contig84489.19698.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84489.19698.1 vs. uniprot
Match: A0A6A7GA59_9CRUS (Methyl-accepting chemotaxis protein McpC (Fragment) n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=A0A6A7GA59_9CRUS) HSP 1 Score: 63.5 bits (153), Expect = 1.540e-8 Identity = 39/124 (31.45%), Postives = 63/124 (50.81%), Query Frame = 0 Query: 1 MNDFEMGLVDAAVRAQVLQNGYGFLVGQDGRCVVHPSLDWSTASEAPSAVSLEYPDASTPSDPLQEPSSSLPSTFFEKVQEPMVAGEKGTARVVKEDGSKWIYAWNPVPSASYSLAITVPVSDV 124 ++ F+ + D ++ L NGYGF++ QDG V+HP D+S A S + LE+ SS F+ + + M+ +G K DG+KW ++ PV +A +SLA+ VP D+ Sbjct: 179 LSSFKTAVADFSI----LDNGYGFVISQDGNVVIHPDFDYSNAI---SFLDLEF-------------DSSADKDGFQHILDEMINEGEGDDNFQK-DGAKWFISYAPVKAAGFSLALVVPEEDI 281 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84489.19698.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig84489.19698.1 ID=prot_M-pyrifera_M_contig84489.19698.1|Name=mRNA_M-pyrifera_M_contig84489.19698.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=178bpback to top |