prot_M-pyrifera_M_contig84292.19666.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Match: A0A517PHY8_9PLAN (Uncharacterized protein n=1 Tax=Gimesia chilikensis TaxID=2605989 RepID=A0A517PHY8_9PLAN) HSP 1 Score: 108 bits (269), Expect = 1.780e-28 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 0 Query: 1 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADIS 58 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADIS Sbjct: 114 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADIS 171
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Match: A0A517W736_9PLAN (Uncharacterized protein n=1 Tax=Gimesia chilikensis TaxID=2605989 RepID=A0A517W736_9PLAN) HSP 1 Score: 85.9 bits (211), Expect = 1.020e-19 Identity = 46/54 (85.19%), Postives = 49/54 (90.74%), Query Frame = 0 Query: 1 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQ 54 LVRSADEDIQAASLIA+GQI SPRVL LLE +S S LTEEIRELVGNL+DDQRQ Sbjct: 114 LVRSADEDIQAASLIALGQIISPRVLTLLEALSLSTLTEEIRELVGNLLDDQRQ 167
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Match: A6C0Z9_9PLAN (Uncharacterized protein n=2 Tax=Gimesia maris TaxID=122 RepID=A6C0Z9_9PLAN) HSP 1 Score: 68.6 bits (166), Expect = 3.380e-13 Identity = 40/57 (70.18%), Postives = 44/57 (77.19%), Query Frame = 0 Query: 1 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADI 57 LVRSA+ED+ AASLIAV QIKSPRV ALLE +S PLT+EIR V N ID QRQ I Sbjct: 89 LVRSANEDLLAASLIAVRQIKSPRVPALLEALSCFPLTDEIRASVANHIDKQRQDQI 145 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig84292.19666.1 ID=prot_M-pyrifera_M_contig84292.19666.1|Name=mRNA_M-pyrifera_M_contig84292.19666.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=59bpback to top |