mRNA_M-pyrifera_M_contig84292.19666.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Match: A0A517PHY8_9PLAN (Uncharacterized protein n=1 Tax=Gimesia chilikensis TaxID=2605989 RepID=A0A517PHY8_9PLAN) HSP 1 Score: 108 bits (269), Expect = 1.780e-28 Identity = 58/58 (100.00%), Postives = 58/58 (100.00%), Query Frame = 1 Query: 1 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADIS 174 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADIS Sbjct: 114 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADIS 171
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Match: A0A517W736_9PLAN (Uncharacterized protein n=1 Tax=Gimesia chilikensis TaxID=2605989 RepID=A0A517W736_9PLAN) HSP 1 Score: 85.9 bits (211), Expect = 1.020e-19 Identity = 46/54 (85.19%), Postives = 49/54 (90.74%), Query Frame = 1 Query: 1 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQ 162 LVRSADEDIQAASLIA+GQI SPRVL LLE +S S LTEEIRELVGNL+DDQRQ Sbjct: 114 LVRSADEDIQAASLIALGQIISPRVLTLLEALSLSTLTEEIRELVGNLLDDQRQ 167
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Match: A6C0Z9_9PLAN (Uncharacterized protein n=2 Tax=Gimesia maris TaxID=122 RepID=A6C0Z9_9PLAN) HSP 1 Score: 68.6 bits (166), Expect = 3.380e-13 Identity = 40/57 (70.18%), Postives = 44/57 (77.19%), Query Frame = 1 Query: 1 LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDDQRQADI 171 LVRSA+ED+ AASLIAV QIKSPRV ALLE +S PLT+EIR V N ID QRQ I Sbjct: 89 LVRSANEDLLAASLIAVRQIKSPRVPALLEALSCFPLTDEIRASVANHIDKQRQDQI 145 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84292.19666.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84292.19666.1 >prot_M-pyrifera_M_contig84292.19666.1 ID=prot_M-pyrifera_M_contig84292.19666.1|Name=mRNA_M-pyrifera_M_contig84292.19666.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=59bp LVRSADEDIQAASLIAVGQIKSPRVLALLEEVSRSPLTEEIRELVGNLIDback to top mRNA from alignment at M-pyrifera_M_contig84292:2..178+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84292.19666.1 ID=mRNA_M-pyrifera_M_contig84292.19666.1|Name=mRNA_M-pyrifera_M_contig84292.19666.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=177bp|location=Sequence derived from alignment at M-pyrifera_M_contig84292:2..178+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84292:2..178+ >mRNA_M-pyrifera_M_contig84292.19666.1 ID=mRNA_M-pyrifera_M_contig84292.19666.1|Name=mRNA_M-pyrifera_M_contig84292.19666.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=354bp|location=Sequence derived from alignment at M-pyrifera_M_contig84292:2..178+ (Macrocystis pyrifera P11B4 male)back to top |