prot_M-pyrifera_M_contig84042.19608.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: A0A6H5IUI4_9HYME (Uncharacterized protein n=1 Tax=Trichogramma brassicae TaxID=86971 RepID=A0A6H5IUI4_9HYME) HSP 1 Score: 60.1 bits (144), Expect = 6.800e-9 Identity = 26/47 (55.32%), Postives = 33/47 (70.21%), Query Frame = 0 Query: 22 VRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 + A D+KG T LH A N NE +I LL +DADPN+ D+ GSTPLH+ Sbjct: 237 INARDNKGNTPLHSAMRNSNEKMIELLLRNDADPNIVDVEGSTPLHI 283
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: A0A6H5I5Q9_9HYME (Uncharacterized protein n=1 Tax=Trichogramma brassicae TaxID=86971 RepID=A0A6H5I5Q9_9HYME) HSP 1 Score: 57.8 bits (138), Expect = 4.390e-8 Identity = 26/47 (55.32%), Postives = 33/47 (70.21%), Query Frame = 0 Query: 22 VRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 + A D GRT LH+A + DN+ L LL +ADPNV DL+GSTPLH+ Sbjct: 654 IDAQDKLGRTPLHYALARDNKKLAEMLLRRNADPNVADLDGSTPLHI 700
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: A0A6H5J5W4_9HYME (Uncharacterized protein n=1 Tax=Trichogramma brassicae TaxID=86971 RepID=A0A6H5J5W4_9HYME) HSP 1 Score: 57.4 bits (137), Expect = 6.020e-8 Identity = 25/47 (53.19%), Postives = 33/47 (70.21%), Query Frame = 0 Query: 22 VRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 + D+KG T LHFA SN+ ++ FLLE+ ADPN ++ GSTPLHL Sbjct: 292 INTRDNKGNTPLHFAVSNNRPEVTKFLLEYGADPNASNQEGSTPLHL 338
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: UPI0006C97472 (ankyrin-3-like n=1 Tax=Trichogramma pretiosum TaxID=7493 RepID=UPI0006C97472) HSP 1 Score: 55.8 bits (133), Expect = 2.080e-7 Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 0 Query: 24 AADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 A D GRT LH+A + DN+ L LL +ADPNV DL+GSTPLH+ Sbjct: 471 AQDKLGRTPLHYALARDNKKLAEMLLIRNADPNVADLDGSTPLHI 515
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: A0A6H5IYG2_9HYME (Uncharacterized protein n=1 Tax=Trichogramma brassicae TaxID=86971 RepID=A0A6H5IYG2_9HYME) HSP 1 Score: 55.5 bits (132), Expect = 2.830e-7 Identity = 24/47 (51.06%), Postives = 33/47 (70.21%), Query Frame = 0 Query: 22 VRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 V A D+KGRT LH A +N D++ ++L+ ADPN+TD G TPLH+ Sbjct: 228 VDARDNKGRTPLHLALERENNDVVKYVLKRGADPNLTDEEGFTPLHV 274
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: A0A6H5J531_9HYME (Uncharacterized protein n=1 Tax=Trichogramma brassicae TaxID=86971 RepID=A0A6H5J531_9HYME) HSP 1 Score: 55.5 bits (132), Expect = 2.850e-7 Identity = 28/46 (60.87%), Postives = 29/46 (63.04%), Query Frame = 0 Query: 22 VRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLH 67 V A D KGRT LH A S DL A LL ADPN+ DL GSTPLH Sbjct: 290 VNAQDKKGRTPLHLALSRGYNDLAALLLISGADPNLADLEGSTPLH 335
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: A0A6P6XNI3_DERPT (uncharacterized protein LOC113789128 n=1 Tax=Dermatophagoides pteronyssinus TaxID=6956 RepID=A0A6P6XNI3_DERPT) HSP 1 Score: 52.8 bits (125), Expect = 2.610e-6 Identity = 23/40 (57.50%), Postives = 31/40 (77.50%), Query Frame = 0 Query: 29 GRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 G T LH+A+ N ++D++ LLEH A+PNV D NGS+PLHL Sbjct: 52 GFTCLHYASLNGHKDIVRILLEHGANPNVVDHNGSSPLHL 91
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: UPI0006C94860 (ankyrin-3-like n=1 Tax=Trichogramma pretiosum TaxID=7493 RepID=UPI0006C94860) HSP 1 Score: 52.0 bits (123), Expect = 4.800e-6 Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 0 Query: 22 VRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 + A D+ GRT+LH A ND E++ FLL+ DA+PN+ + G TPLH+ Sbjct: 61 IDARDNFGRTALHLAVYNDLEEITEFLLDRDANPNLANDKGETPLHV 107
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: UPI0018A08841 (ankyrin repeat domain-containing protein 22 n=1 Tax=Sebastes umbrosus TaxID=72105 RepID=UPI0018A08841) HSP 1 Score: 48.9 bits (115), Expect = 4.960e-6 Identity = 21/48 (43.75%), Postives = 31/48 (64.58%), Query Frame = 0 Query: 21 NVRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLHL 68 NV A D KG T+LH+ ++ L+ LLE +ADPN+ + +G TPL + Sbjct: 10 NVDAVDYKGNTALHYVCQRKSQRLVPLLLERNADPNIQNYDGETPLDI 57
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Match: A0A6J8DKQ9_MYTCO (Uncharacterized protein n=2 Tax=Mytilus TaxID=6548 RepID=A0A6J8DKQ9_MYTCO) HSP 1 Score: 51.2 bits (121), Expect = 7.660e-6 Identity = 24/46 (52.17%), Postives = 32/46 (69.57%), Query Frame = 0 Query: 22 VRAADSKGRTSLHFAASNDNEDLIAFLLEHDADPNVTDLNGSTPLH 67 + A DSKGRTSL+FAA N++L+ LLE ADPN+ D + P+H Sbjct: 42 INATDSKGRTSLYFAAKYGNKELLRHLLELGADPNIPDSTLTFPIH 87 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84042.19608.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig84042.19608.1 ID=prot_M-pyrifera_M_contig84042.19608.1|Name=mRNA_M-pyrifera_M_contig84042.19608.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=69bpback to top |