prot_M-pyrifera_M_contig8348.19493.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8348.19493.1 vs. uniprot
Match: A0A8J3AA54_9ACTN (GMP synthase n=1 Tax=Egicoccus halophilus TaxID=1670830 RepID=A0A8J3AA54_9ACTN) HSP 1 Score: 53.1 bits (126), Expect = 6.360e-6 Identity = 25/64 (39.06%), Postives = 33/64 (51.56%), Query Frame = 0 Query: 28 RLLYHHNDEVVKLPPGATNISTSRHCQIHGMIMDTEGEGEEPRPNILAFQAHPELNYEYGRRVM 91 RLL H D+VV+LP GAT ++TSRH + D N+L FQ HPE Y ++ Sbjct: 142 RLLVSHQDQVVRLPEGATRVATSRHAPVAAFQRD----------NVLGFQGHPEFTPPYAEALL 195
BLAST of mRNA_M-pyrifera_M_contig8348.19493.1 vs. uniprot
Match: A0A7X7HTC3_9ACTN (GATase domain-containing protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A7X7HTC3_9ACTN) HSP 1 Score: 51.6 bits (122), Expect = 2.490e-5 Identity = 26/73 (35.62%), Postives = 40/73 (54.79%), Query Frame = 0 Query: 24 PPRMRLLYHHNDEVVKLPPGATNISTSRHCQIHGMIMDTEGEGEEPRPNILAFQAHPELNYEYGRRVMDGILD 96 P + LL H D+V +LP GAT +++S HC + + GE +LA QAHPE E R +++G ++ Sbjct: 153 PAHLDLLAMHQDQVTRLPEGATVLASSEHCPVAAYSL-----GER----VLAVQAHPEFTPELTRELIEGRIE 216
BLAST of mRNA_M-pyrifera_M_contig8348.19493.1 vs. uniprot
Match: UPI0007861F7A (hypothetical protein n=1 Tax=Endozoicomonas arenosclerae TaxID=1633495 RepID=UPI0007861F7A) HSP 1 Score: 50.1 bits (118), Expect = 8.320e-5 Identity = 23/65 (35.38%), Postives = 36/65 (55.38%), Query Frame = 0 Query: 27 MRLLYHHNDEVVKLPPGATNISTSRHCQIHGMIMDTEGEGEEPRPNILAFQAHPELNYEYGRRVM 91 RL+++H D+VV+LP GA I ++ +C I M++ +IL Q HPE EY R ++ Sbjct: 141 FRLIFNHQDQVVRLPEGAELIGSTPNCPIAAMLIGD---------HILTLQGHPEFTPEYARELL 196 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8348.19493.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8348.19493.1 ID=prot_M-pyrifera_M_contig8348.19493.1|Name=mRNA_M-pyrifera_M_contig8348.19493.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=115bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|