prot_M-pyrifera_M_contig8083.18908.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8083.18908.1 vs. uniprot
Match: A0A6H5KYS1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KYS1_9PHAE) HSP 1 Score: 93.2 bits (230), Expect = 4.590e-21 Identity = 45/62 (72.58%), Postives = 54/62 (87.10%), Query Frame = 0 Query: 14 LPGQYVFDVVTNNLGALERVSRTAYRLVCVAEDSSSALDGRSAATILRQSCPGLSVILLLND 75 LPG YVFDVVTNN GALERVSR+ YRLVCVA++S SALDGR AT++R+S P L+V+LLL+D Sbjct: 2 LPGSYVFDVVTNNFGALERVSRSKYRLVCVAQESRSALDGRKVATVIRRSFPDLTVVLLLDD 63
BLAST of mRNA_M-pyrifera_M_contig8083.18908.1 vs. uniprot
Match: D8LSI4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LSI4_ECTSI) HSP 1 Score: 91.3 bits (225), Expect = 2.380e-20 Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = 0 Query: 14 LPGQYVFDVVTNNLGALERVSRTAYRLVCVAEDSSSALDGRSAATILRQSCPGLSVILLLNDSKQR 79 LPG YVFDVVTNN GALERVSR+ YRLVCVA++S SALDGR A ++R+S P L+V+LLL+D R Sbjct: 2 LPGSYVFDVVTNNFGALERVSRSKYRLVCVAQESRSALDGRRVAMVIRRSFPDLTVVLLLDDDDVR 67 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8083.18908.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig8083.18908.1 ID=prot_M-pyrifera_M_contig8083.18908.1|Name=mRNA_M-pyrifera_M_contig8083.18908.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=79bpback to top |