prot_M-pyrifera_M_contig80789.18902.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80789.18902.1 vs. uniprot
Match: A0A3M8G6G2_9BACT (MBL fold metallo-hydrolase n=1 Tax=Balneola sp. TaxID=2024824 RepID=A0A3M8G6G2_9BACT) HSP 1 Score: 60.1 bits (144), Expect = 1.490e-9 Identity = 26/37 (70.27%), Postives = 33/37 (89.19%), Query Frame = 0 Query: 1 ILRQAVREKAALFFYHSIHVKNGVLVQDEEKRYALLD 37 ILRQA++EKA L FYHSIH K+G LVQDE+K+YAL++ Sbjct: 244 ILRQALKEKATLLFYHSIHTKSGKLVQDEDKKYALIE 280
BLAST of mRNA_M-pyrifera_M_contig80789.18902.1 vs. uniprot
Match: A0A3D1GDF4_9BACT (Lactamase_B domain-containing protein n=1 Tax=Balneolaceae bacterium TaxID=2053516 RepID=A0A3D1GDF4_9BACT) HSP 1 Score: 60.1 bits (144), Expect = 1.490e-9 Identity = 26/39 (66.67%), Postives = 33/39 (84.62%), Query Frame = 0 Query: 1 ILRQAVREKAALFFYHSIHVKNGVLVQDEEKRYALLDVK 39 ILRQA++E+A + FYHSIH K G L+QDEE+RYAL +VK Sbjct: 244 ILRQALKERATILFYHSIHTKYGKLIQDEERRYALAEVK 282
BLAST of mRNA_M-pyrifera_M_contig80789.18902.1 vs. uniprot
Match: A0A316TP32_9BACT (Lactamase_B domain-containing protein n=1 Tax=Rhodohalobacter mucosus TaxID=2079485 RepID=A0A316TP32_9BACT) HSP 1 Score: 50.4 bits (119), Expect = 4.490e-6 Identity = 21/38 (55.26%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 1 ILRQAVREKAALFFYHSIHVKNGVLVQDEEKRYALLDV 38 +LRQA++EKA +FFYHS++ K+G + D++KRY L DV Sbjct: 244 LLRQALKEKAVMFFYHSLYKKSGQISLDKKKRYVLKDV 281
BLAST of mRNA_M-pyrifera_M_contig80789.18902.1 vs. uniprot
Match: A0A6A8Q9H6_9BACT (MBL fold metallo-hydrolase n=1 Tax=Balneolaceae bacterium TaxID=2053516 RepID=A0A6A8Q9H6_9BACT) HSP 1 Score: 47.8 bits (112), Expect = 4.140e-5 Identity = 21/39 (53.85%), Postives = 30/39 (76.92%), Query Frame = 0 Query: 1 ILRQAVREKAALFFYHSIHVKNGVLVQDEEKRYALLDVK 39 IL+QA++EKA L FYHSIHVK G L + + K++ L ++K Sbjct: 243 ILKQALKEKAYLLFYHSIHVKAGRLERTKNKKFGLKEIK 281 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80789.18902.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80789.18902.1 ID=prot_M-pyrifera_M_contig80789.18902.1|Name=mRNA_M-pyrifera_M_contig80789.18902.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bpback to top |