prot_M-pyrifera_M_contig80600.18870.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80600.18870.1 vs. uniprot
Match: D7G5M9_ECTSI (STI1 domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5M9_ECTSI) HSP 1 Score: 94.0 bits (232), Expect = 1.840e-23 Identity = 44/57 (77.19%), Postives = 52/57 (91.23%), Query Frame = 0 Query: 26 GKIMNNPKAMEAFQKAQGSPKVMAAIQDVTQNGMGAIAKYRNDPEILAVIEELKAMF 82 GK+MNNPKAMEAFQKAQ + VMAAIQDVTQNGM A++KY++DPEILA+IEELK +F Sbjct: 29 GKMMNNPKAMEAFQKAQSNXXVMAAIQDVTQNGMSAMSKYQDDPEILAIIEELKGLF 85
BLAST of mRNA_M-pyrifera_M_contig80600.18870.1 vs. uniprot
Match: D7G4D5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4D5_ECTSI) HSP 1 Score: 94.0 bits (232), Expect = 1.440e-20 Identity = 44/57 (77.19%), Postives = 52/57 (91.23%), Query Frame = 0 Query: 26 GKIMNNPKAMEAFQKAQGSPKVMAAIQDVTQNGMGAIAKYRNDPEILAVIEELKAMF 82 GK+MNNPKAMEAFQKAQ + VMAAIQDVTQNGM A++KY++DPEILA+IEELK +F Sbjct: 831 GKMMNNPKAMEAFQKAQSNXXVMAAIQDVTQNGMSAMSKYQDDPEILAIIEELKGLF 887 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80600.18870.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80600.18870.1 ID=prot_M-pyrifera_M_contig80600.18870.1|Name=mRNA_M-pyrifera_M_contig80600.18870.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=83bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|