prot_M-pyrifera_M_contig80502.18861.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80502.18861.1 vs. uniprot
Match: A0A316UVT4_9BASI (WD40 repeat-like protein n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=A0A316UVT4_9BASI) HSP 1 Score: 50.1 bits (118), Expect = 9.950e-5 Identity = 38/106 (35.85%), Postives = 55/106 (51.89%), Query Frame = 0 Query: 5 ADKVVATGCDDGSVVLVGVETGARLPALH-HGESVTHLSFSSSSRYLASGSESL-LKVWDLKHRRGGVPLLEYALSSPLVSVSFDRSQRRVL-AVLESGTALLWEL 107 A + +A D +V + +ET + + L H VT L +SS+ R+L SGS + VWDLK R GG +P+ V+F RVL VLES A++ +L Sbjct: 42 AGQYIAAARADCAVAIYDLETRSLVRFLEGHVRPVTSLDWSSTGRFLVSGSMDWNVVVWDLKKREGGARTRTIRFDAPVSQVTFAPGTSRVLLVVLESQQAIVVDL 147 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80502.18861.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80502.18861.1 ID=prot_M-pyrifera_M_contig80502.18861.1|Name=mRNA_M-pyrifera_M_contig80502.18861.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=110bpback to top |