prot_M-pyrifera_M_contig80501.18860.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80501.18860.1 vs. uniprot
Match: A0A1G0PFD0_9BACT (Uncharacterized protein n=1 Tax=Ignavibacteria bacterium GWB2_35_6b TaxID=1798424 RepID=A0A1G0PFD0_9BACT) HSP 1 Score: 57.0 bits (136), Expect = 1.460e-8 Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 0 Query: 1 YDSNNVEHQLIKSTIDKYHKGLTMGDGDLVTKALADQFFMYNGNYSGDAINWQAHMYL 58 Y N + L K + + G+ + +L+ ++ + F M+NGNYSGD +NWQAHMYL Sbjct: 31 YFLNESDSVLAKQAVTNFQTGIINNNAELLKNSVWEDFIMFNGNYSGDPVNWQAHMYL 88 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80501.18860.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig80501.18860.1 ID=prot_M-pyrifera_M_contig80501.18860.1|Name=mRNA_M-pyrifera_M_contig80501.18860.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=58bpback to top |