mRNA_M-pyrifera_M_contig80501.18860.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig80501.18860.1 vs. uniprot
Match: A0A1G0PFD0_9BACT (Uncharacterized protein n=1 Tax=Ignavibacteria bacterium GWB2_35_6b TaxID=1798424 RepID=A0A1G0PFD0_9BACT) HSP 1 Score: 57.0 bits (136), Expect = 1.460e-8 Identity = 23/58 (39.66%), Postives = 35/58 (60.34%), Query Frame = 1 Query: 1 YDSNNVEHQLIKSTIDKYHKGLTMGDGDLVTKALADQFFMYNGNYSGDAINWQAHMYL 174 Y N + L K + + G+ + +L+ ++ + F M+NGNYSGD +NWQAHMYL Sbjct: 31 YFLNESDSVLAKQAVTNFQTGIINNNAELLKNSVWEDFIMFNGNYSGDPVNWQAHMYL 88 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig80501.18860.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig80501.18860.1 >prot_M-pyrifera_M_contig80501.18860.1 ID=prot_M-pyrifera_M_contig80501.18860.1|Name=mRNA_M-pyrifera_M_contig80501.18860.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=58bp YDSNNVEHQLIKSTIDKYHKGLTMGDGDLVTKALADQFFMYNGNYSGDAIback to top mRNA from alignment at M-pyrifera_M_contig80501:758..931+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig80501.18860.1 ID=mRNA_M-pyrifera_M_contig80501.18860.1|Name=mRNA_M-pyrifera_M_contig80501.18860.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=174bp|location=Sequence derived from alignment at M-pyrifera_M_contig80501:758..931+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig80501:758..931+ >mRNA_M-pyrifera_M_contig80501.18860.1 ID=mRNA_M-pyrifera_M_contig80501.18860.1|Name=mRNA_M-pyrifera_M_contig80501.18860.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=348bp|location=Sequence derived from alignment at M-pyrifera_M_contig80501:758..931+ (Macrocystis pyrifera P11B4 male)back to top |