prot_M-pyrifera_M_contig77942.18337.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77942.18337.1 vs. uniprot
Match: M5FWI2_DACPD (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Dacryopinax primogenitus (strain DJM 731) TaxID=1858805 RepID=M5FWI2_DACPD) HSP 1 Score: 50.8 bits (120), Expect = 1.970e-5 Identity = 21/43 (48.84%), Postives = 27/43 (62.79%), Query Frame = 0 Query: 1 PLLPRTLSCAACARSKRKCDGGQPCDRCERLGKGLECVYPIDR 43 PL +++CA C + K +C GGQPC RCE+LG EC P R Sbjct: 22 PLARTSVACARCRQQKLRCSGGQPCQRCEKLGFARECHLPPPR 64 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77942.18337.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77942.18337.1 ID=prot_M-pyrifera_M_contig77942.18337.1|Name=mRNA_M-pyrifera_M_contig77942.18337.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=81bpback to top |