mRNA_M-pyrifera_M_contig77942.18337.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77942.18337.1 vs. uniprot
Match: M5FWI2_DACPD (Zn(2)-C6 fungal-type domain-containing protein n=1 Tax=Dacryopinax primogenitus (strain DJM 731) TaxID=1858805 RepID=M5FWI2_DACPD) HSP 1 Score: 50.8 bits (120), Expect = 1.970e-5 Identity = 21/43 (48.84%), Postives = 27/43 (62.79%), Query Frame = 1 Query: 1 PLLPRTLSCAACARSKRKCDGGQPCDRCERLGKGLECVYPIDR 129 PL +++CA C + K +C GGQPC RCE+LG EC P R Sbjct: 22 PLARTSVACARCRQQKLRCSGGQPCQRCEKLGFARECHLPPPR 64 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77942.18337.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig77942.18337.1 >prot_M-pyrifera_M_contig77942.18337.1 ID=prot_M-pyrifera_M_contig77942.18337.1|Name=mRNA_M-pyrifera_M_contig77942.18337.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=81bp PLLPRTLSCAACARSKRKCDGGQPCDRCERLGKGLECVYPIDRRRLRLPEback to top mRNA from alignment at M-pyrifera_M_contig77942:2..244+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig77942.18337.1 ID=mRNA_M-pyrifera_M_contig77942.18337.1|Name=mRNA_M-pyrifera_M_contig77942.18337.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=243bp|location=Sequence derived from alignment at M-pyrifera_M_contig77942:2..244+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig77942:2..244+ >mRNA_M-pyrifera_M_contig77942.18337.1 ID=mRNA_M-pyrifera_M_contig77942.18337.1|Name=mRNA_M-pyrifera_M_contig77942.18337.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=486bp|location=Sequence derived from alignment at M-pyrifera_M_contig77942:2..244+ (Macrocystis pyrifera P11B4 male)back to top |