Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | COILS | Coil | Coil | coord: 165..185 |
IPR026270 | Signal recognition particle, SRP72 subunit | PANTHER | PTHR14094 | SIGNAL RECOGNITION PARTICLE 72 | coord: 8..199 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77127.18179.1 ID=prot_M-pyrifera_M_contig77127.18179.1|Name=mRNA_M-pyrifera_M_contig77127.18179.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=199bp VRVNLSGALLCAGRAREARLVEDVDRSALHAEEVADAWDLLYQRACAAAD EGSMVEAVKGLSSAAKLAAEEGEGVDAEAKLQRAALLHRLLWRTEASAEA AMIARGMEDAALSAVARNNDTAARRDRKDVVDALRRTTEALTKDAENPKL TPGQVLALRANKCVLLLALGKASEAESEAADLEKDCPLAATPALIRASV back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR026270 | SRP72 |
|