|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR006593 | Cytochrome b561/ferric reductase transmembrane | SMART | SM00665 | 561_7 | coord: 7..148 e-value: 5.1E-9 score: 46.0 |
IPR006593 | Cytochrome b561/ferric reductase transmembrane | PFAM | PF03188 | Cytochrom_B561 | coord: 55..148 e-value: 3.2E-10 score: 40.3 |
IPR006593 | Cytochrome b561/ferric reductase transmembrane | PROSITE | PS50939 | CYTOCHROME_B561 | coord: 1..150 score: 21.692 |
None | No IPR available | GENE3D | 1.20.120.1770 | | coord: 2..150 e-value: 2.1E-11 score: 45.4 |
None | No IPR available | PANTHER | PTHR15422 | FAMILY NOT NAMED | coord: 7..149 |
None | No IPR available | PANTHER | PTHR15422:SF24 | | coord: 7..149 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 1..5 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 30..57 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 149..150 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 126..148 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 93..114 |
None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 82..92 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 6..29 |
None | No IPR available | PHOBIUS | TRANSMEMBRANE | Transmembrane region | coord: 58..81 |
None | No IPR available | PHOBIUS | CYTOPLASMIC_DOMAIN | Cytoplasmic domain | coord: 115..125 |
None | No IPR available | TMHMM | TMhelix | | coord: 58..80 |
None | No IPR available | TMHMM | TMhelix | | coord: 126..148 |
None | No IPR available | TMHMM | TMhelix | | coord: 95..114 |
None | No IPR available | TMHMM | TMhelix | | coord: 5..27 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77113.18170.1 ID=prot_M-pyrifera_M_contig77113.18170.1|Name=mRNA_M-pyrifera_M_contig77113.18170.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=150bp METALVMHSCMLALAFVVVTPISIVVSRYGRQWRWVRRFPVTSLSGEGPA SRWFDLHLAFQLVAQVAIALGVVLPFCFLVDQDTFNHFPSLHSWLGLGLI VAFCVAQPILGLPSDEATKKERQQQLWLHSILGRALVVTGFWCIYLGFDR back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR006593 | Cyt_b561/ferric_Rdtase_TM |
|