prot_M-pyrifera_M_contig77065.18161.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig77065.18161.1 vs. uniprot
Match: A0A1S8W6C9_9FUNG (Uncharacterized protein n=1 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8W6C9_9FUNG) HSP 1 Score: 53.9 bits (128), Expect = 3.940e-5 Identity = 30/61 (49.18%), Postives = 36/61 (59.02%), Query Frame = 0 Query: 147 PFQPTYTPTQYDNMGV------GDNNIEQAMRHSKYAVSALQFEDVQAAVSNLQKALAFLQ 201 P+ P T YD+ + QA RHSK+A+SALQFEDV A+ NLQKALA LQ Sbjct: 271 PYPPAATTPDYDSNATILFDEQASKVMAQAQRHSKFAISALQFEDVPTAIDNLQKALALLQ 331 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig77065.18161.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig77065.18161.1 ID=prot_M-pyrifera_M_contig77065.18161.1|Name=mRNA_M-pyrifera_M_contig77065.18161.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=203bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|