prot_M-pyrifera_M_contig76891.18113.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig76891.18113.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
KWRTVVGDAEALPFADNAFDTVVDTFGLCSMDSPVSALREMRRVCKPDGKILLLEHGRGTWDIVNYLLDRNAQKHADKFGCWYNRDIPALIAASGLRVVSRTRWHFGTTLVYECARN*102030405060708090100110Expect = 6.36e-53 / Id = 71.43Expect = 2.41e-40 / Id = 60.58Expect = 3.20e-40 / Id = 60.58Expect = 3.73e-39 / Id = 59.62Expect = 1.21e-38 / Id = 58.26Expect = 8.36e-38 / Id = 60.00Expect = 9.02e-38 / Id = 63.37Expect = 1.58e-37 / Id = 52.17Expect = 1.93e-37 / Id = 63.37Expect = 3.23e-37 / Id = 55.14SequenceA0A5A8DS19_CAFROA0A7R9UFL9_9STRAA0A7S1U426_9STRAA0A7S1QTC6_NEODSB7FUN7_PHATCG0U1D7_TRYVYG0USD6_TRYCIA0A7S2DMV5_9DINOA0A0S4KJ69_BODSAA0A0L1KZG9_9EUGL
Match NameE-valueIdentityDescription
A0A5A8DS19_CAFRO6.360e-5371.43Uncharacterized protein n=1 Tax=Cafeteria roenberg... [more]
A0A7R9UFL9_9STRA2.410e-4060.58Hypothetical protein n=1 Tax=Pinguiococcus pyrenoi... [more]
A0A7S1U426_9STRA3.200e-4060.58Hypothetical protein n=1 Tax=Phaeomonas parva TaxI... [more]
A0A7S1QTC6_NEODS3.730e-3959.62Hypothetical protein (Fragment) n=1 Tax=Neobodo de... [more]
B7FUN7_PHATC1.210e-3858.26Predicted protein n=2 Tax=Phaeodactylum tricornutu... [more]
G0U1D7_TRYVY8.360e-3860.00Uncharacterized protein n=1 Tax=Trypanosoma vivax ... [more]
G0USD6_TRYCI9.020e-3863.37Uncharacterized protein n=1 Tax=Trypanosoma congol... [more]
A0A7S2DMV5_9DINO1.580e-3752.17Hypothetical protein n=1 Tax=Alexandrium andersoni... [more]
A0A0S4KJ69_BODSA1.930e-3763.37Methyltransferase, putative (Fragment) n=1 Tax=Bod... [more]
A0A0L1KZG9_9EUGL3.230e-3755.14Uncharacterized protein n=1 Tax=Perkinsela sp. CCA... [more]

Pages

back to top