prot_M-pyrifera_M_contig75821.17886.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75821.17886.1 vs. uniprot
Match: A0A534Q683_9DELT (Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A534Q683_9DELT) HSP 1 Score: 48.9 bits (115), Expect = 1.020e-5 Identity = 27/71 (38.03%), Postives = 36/71 (50.70%), Query Frame = 0 Query: 1 PQASGTVRGTLEVGGWILRPEDGTAPLQDAKSTLATYVVISDPGGGIPTFLVERVLAGQMRLGEALAKAIK 71 P G +R + G W + P DG K TLATY +++DPGG IPTF+ + A L E A+ K Sbjct: 28 PPEDGVIRLKVNTGSWTMEPIDG------GKRTLATYQLLTDPGGSIPTFIANK--ANTKALPELFARVRK 90 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75821.17886.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75821.17886.1 ID=prot_M-pyrifera_M_contig75821.17886.1|Name=mRNA_M-pyrifera_M_contig75821.17886.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=76bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|