prot_M-pyrifera_M_contig75315.17777.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig75315.17777.1 vs. uniprot
Match: A0A6H5LET2_9PHAE (Acyltransf_C domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5LET2_9PHAE) HSP 1 Score: 74.3 bits (181), Expect = 3.300e-14 Identity = 35/54 (64.81%), Postives = 42/54 (77.78%), Query Frame = 0 Query: 3 LLLPHTTALAASLDGLRPAKPVIYDVTLAASGYSGEIPCG--PPPSDWEALKGI 54 LLLPHTTAL+A LDGLR AKPV+YD TLAA Y+GEIP PP+DW+ L+ + Sbjct: 133 LLLPHTTALSACLDGLRQAKPVVYDFTLAADAYTGEIPPARRSPPTDWDVLRAL 186
BLAST of mRNA_M-pyrifera_M_contig75315.17777.1 vs. uniprot
Match: D7FLT9_ECTSI (1-acyl-sn-glycerol-3-phosphate acyltransferase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FLT9_ECTSI) HSP 1 Score: 70.5 bits (171), Expect = 7.700e-13 Identity = 34/54 (62.96%), Postives = 40/54 (74.07%), Query Frame = 0 Query: 3 LLLPHTTALAASLDGLRPAKPVIYDVTLAASGYSGEIPCG--PPPSDWEALKGI 54 LLLPHTTAL+A LDGLR AKPV+YD TLAA Y GEIP P +DW+ L+ + Sbjct: 365 LLLPHTTALSACLDGLRQAKPVVYDFTLAADAYMGEIPPARRSPSTDWDVLRAL 418
BLAST of mRNA_M-pyrifera_M_contig75315.17777.1 vs. uniprot
Match: A0A7S1UNY8_9STRA (Hypothetical protein n=1 Tax=Grammatophora oceanica TaxID=210454 RepID=A0A7S1UNY8_9STRA) HSP 1 Score: 50.8 bits (120), Expect = 6.410e-6 Identity = 24/37 (64.86%), Postives = 27/37 (72.97%), Query Frame = 0 Query: 3 LLLPHTTALAASLDGLRPAKPVIYDVTLAASGYSGEI 39 LLLP TT ASLD L A PV+YDVTLA SGY G++ Sbjct: 109 LLLPRTTGFNASLDSLGEANPVVYDVTLAYSGYRGQM 145
BLAST of mRNA_M-pyrifera_M_contig75315.17777.1 vs. uniprot
Match: I6R0X4_PHATR (Lysophosphatidic acid acyltransferase n=2 Tax=Phaeodactylum tricornutum TaxID=2850 RepID=I6R0X4_PHATR) HSP 1 Score: 49.3 bits (116), Expect = 2.280e-5 Identity = 25/55 (45.45%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 3 LLLPHTTALAASLDGLRPAKPVIYDVTLAASGYSGEIPCGPP---PSDWEALKGI 54 LLLP ASL+ LR + PV+YDVT+A SGY+G +P P+ W+ L+G Sbjct: 318 LLLPRARGFNASLECLRESSPVVYDVTMAYSGYNGSLPPSIELTFPALWKLLRGF 372 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig75315.17777.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 4
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig75315.17777.1 ID=prot_M-pyrifera_M_contig75315.17777.1|Name=mRNA_M-pyrifera_M_contig75315.17777.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=54bpback to top |