prot_M-pyrifera_M_contig74007.17525.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74007.17525.1 vs. uniprot
Match: D8LCQ3_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LCQ3_ECTSI) HSP 1 Score: 60.5 bits (145), Expect = 1.290e-9 Identity = 24/34 (70.59%), Postives = 28/34 (82.35%), Query Frame = 0 Query: 1 MTDKFFDPASTNTALHNPWDALPSYWSDLVKAVG 34 MTDK +DP S N A HNPWDA+P+YW+DL KAVG Sbjct: 268 MTDKIYDPDSDNPAHHNPWDAVPTYWADLAKAVG 301 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74007.17525.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig74007.17525.1 ID=prot_M-pyrifera_M_contig74007.17525.1|Name=mRNA_M-pyrifera_M_contig74007.17525.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bpback to top |