mRNA_M-pyrifera_M_contig74007.17525.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig74007.17525.1 vs. uniprot
Match: D8LCQ3_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LCQ3_ECTSI) HSP 1 Score: 65.1 bits (157), Expect = 3.080e-11 Identity = 26/36 (72.22%), Postives = 30/36 (83.33%), Query Frame = 1 Query: 1 VYMTDKFFDPASTNTALHNPWDALPSYWSDLVKAVG 108 VYMTDK +DP S N A HNPWDA+P+YW+DL KAVG Sbjct: 266 VYMTDKIYDPDSDNPAHHNPWDAVPTYWADLAKAVG 301 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig74007.17525.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig74007.17525.1 >prot_M-pyrifera_M_contig74007.17525.1 ID=prot_M-pyrifera_M_contig74007.17525.1|Name=mRNA_M-pyrifera_M_contig74007.17525.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=40bp MTDKFFDPASTNTALHNPWDALPSYWSDLVKAVGLANEKAback to top mRNA from alignment at M-pyrifera_M_contig74007:713..838- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig74007.17525.1 ID=mRNA_M-pyrifera_M_contig74007.17525.1|Name=mRNA_M-pyrifera_M_contig74007.17525.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=126bp|location=Sequence derived from alignment at M-pyrifera_M_contig74007:713..838- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig74007:713..838- >mRNA_M-pyrifera_M_contig74007.17525.1 ID=mRNA_M-pyrifera_M_contig74007.17525.1|Name=mRNA_M-pyrifera_M_contig74007.17525.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=240bp|location=Sequence derived from alignment at M-pyrifera_M_contig74007:713..838- (Macrocystis pyrifera P11B4 male)back to top |