prot_M-pyrifera_M_contig72510.17237.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig72510.17237.1 vs. uniprot
Match: A0A2S5BB79_9BASI (WES_acyltransf domain-containing protein n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5BB79_9BASI) HSP 1 Score: 52.8 bits (125), Expect = 2.190e-5 Identity = 40/116 (34.48%), Postives = 60/116 (51.72%), Query Frame = 0 Query: 25 TEKPLWRVVLCPGSDESSIGVIVAMNHVLADGTTGSFLVRE---LLRAMSGEEFE-AGEVPLAPAVEDVVDMRPTVGILAGL----LIADKLPWLVACTKAVTDFFSPPPPPLLGP 132 +++PLWRV L PG D S V++A++HV+ADGT L + LLRA G + + LAPA+E ++ ++P+ A L L+ LP + + PP PL P Sbjct: 114 SQQPLWRVWLFPGPDSGSSRVVLAVHHVVADGTGVRNLFSDFLSLLRAPYGTATDNKNDGALAPAMESLLPIQPSFIDTAKLAWSELVLPNLPTFLRPATTLIHLGKPPVHPLKQP 229 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig72510.17237.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig72510.17237.1 ID=prot_M-pyrifera_M_contig72510.17237.1|Name=mRNA_M-pyrifera_M_contig72510.17237.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=132bpback to top |