prot_M-pyrifera_M_contig7174.17090.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig7174.17090.1 vs. uniprot
Match: D7G6W1_ECTSI (Spindle pole body component n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G6W1_ECTSI) HSP 1 Score: 61.2 bits (147), Expect = 3.240e-9 Identity = 30/43 (69.77%), Postives = 36/43 (83.72%), Query Frame = 0 Query: 1 MASIDDTARRYEEALSELVRLLEEKSGKTEILRFLTFRLDFND 43 M +I+DTARR+EE LSEL +LE+K GK EILRFL FRLDFN+ Sbjct: 840 MGNIEDTARRFEEKLSELRCMLEQKCGKMEILRFLIFRLDFNE 882
BLAST of mRNA_M-pyrifera_M_contig7174.17090.1 vs. uniprot
Match: A0A835YR49_9STRA (Spindle pole body component n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YR49_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 1.140e-8 Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 0 Query: 1 MASIDDTARRYEEALSELVRLLEEKSGKTEILRFLTFRLDFNDYYKERRAAVVSPLPPRQDGG 63 +A + +T RRYE A SEL+ +LE +S ++EILR L FRLDFN Y+ RRAA P P G Sbjct: 982 LAHLAETGRRYERAFSELLVMLETESVRSEILRHLVFRLDFNLYHS-RRAAAQPPAPSHAKAG 1043
BLAST of mRNA_M-pyrifera_M_contig7174.17090.1 vs. uniprot
Match: A0A7S3H0B4_9STRA (Spindle pole body component n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3H0B4_9STRA) HSP 1 Score: 55.8 bits (133), Expect = 1.290e-7 Identity = 26/54 (48.15%), Postives = 37/54 (68.52%), Query Frame = 0 Query: 1 MASIDDTARRYEEALSELVRLLEEKSGKTEILRFLTFRLDFNDYYKERRAAVVS 54 ++ ID+ + Y +L+ +L+E+S KTE LRFLTFRLDFNDY+ +RA S Sbjct: 89 VSRIDEAVKEYSTQFEKLMFMLKEQSEKTEYLRFLTFRLDFNDYHAHQRAQGAS 142 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig7174.17090.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig7174.17090.1 ID=prot_M-pyrifera_M_contig7174.17090.1|Name=mRNA_M-pyrifera_M_contig7174.17090.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=74bpback to top |