prot_M-pyrifera_M_contig70680.16872.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70680.16872.1 vs. uniprot
Match: D7FT58_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FT58_ECTSI) HSP 1 Score: 62.8 bits (151), Expect = 5.140e-10 Identity = 35/58 (60.34%), Postives = 42/58 (72.41%), Query Frame = 0 Query: 1 LSSFLEAEKTVRRSRFLTKLSATLRTRAHLVLPAMANFWRVDF--SSKALCEDVERSR 56 L FLEAEKT RR R L +L+ LRTR HLVLPA+ANFWRVD SSK + E V+ ++ Sbjct: 57 LCKFLEAEKTRRRHRVLGELATVLRTRTHLVLPAIANFWRVDLYQSSKGMEERVDAAK 114
BLAST of mRNA_M-pyrifera_M_contig70680.16872.1 vs. uniprot
Match: A0A6H5KR02_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KR02_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 6.320e-9 Identity = 34/58 (58.62%), Postives = 41/58 (70.69%), Query Frame = 0 Query: 1 LSSFLEAEKTVRRSRFLTKLSATLRTRAHLVLPAMANFWRVDF--SSKALCEDVERSR 56 L FLEAEKT RR R L +L+ LRT HLVLPA+ANFWRVD SSK + E V+ ++ Sbjct: 378 LCKFLEAEKTRRRHRVLGELATVLRTWTHLVLPAIANFWRVDLYQSSKGMEERVDAAK 435 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70680.16872.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig70680.16872.1 ID=prot_M-pyrifera_M_contig70680.16872.1|Name=mRNA_M-pyrifera_M_contig70680.16872.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=60bpback to top |