prot_M-pyrifera_M_contig70503.16829.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70503.16829.1 vs. uniprot
Match: D8LTA1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTA1_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 1.070e-11 Identity = 32/43 (74.42%), Postives = 36/43 (83.72%), Query Frame = 0 Query: 1 AVSLIKTVVERGPWMEAMGEGLRRATAGDFTGSLLLYSRLAEV 43 AVSL K VVERGPWM+ M LRRATAGD+ G+L+LYSRLAEV Sbjct: 251 AVSLFKNVVERGPWMDGMQAALRRATAGDYGGALVLYSRLAEV 293
BLAST of mRNA_M-pyrifera_M_contig70503.16829.1 vs. uniprot
Match: A0A6H5JP59_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JP59_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 1.470e-11 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 0 Query: 1 AVSLIKTVVERGPWMEAMGEGLRRATAGDFTGSLLLYSRLAEV 43 AVSL K VVERGPWM+ M LRRATAGD+ G+L+LYSRLAE+ Sbjct: 428 AVSLFKNVVERGPWMDGMQAALRRATAGDYGGALVLYSRLAEI 470 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70503.16829.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig70503.16829.1 ID=prot_M-pyrifera_M_contig70503.16829.1|Name=mRNA_M-pyrifera_M_contig70503.16829.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bpback to top |