mRNA_M-pyrifera_M_contig70503.16829.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig70503.16829.1 vs. uniprot
Match: D8LTA1_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LTA1_ECTSI) HSP 1 Score: 66.6 bits (161), Expect = 1.070e-11 Identity = 32/43 (74.42%), Postives = 36/43 (83.72%), Query Frame = 1 Query: 1 AVSLIKTVVERGPWMEAMGEGLRRATAGDFTGSLLLYSRLAEV 129 AVSL K VVERGPWM+ M LRRATAGD+ G+L+LYSRLAEV Sbjct: 251 AVSLFKNVVERGPWMDGMQAALRRATAGDYGGALVLYSRLAEV 293
BLAST of mRNA_M-pyrifera_M_contig70503.16829.1 vs. uniprot
Match: A0A6H5JP59_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JP59_9PHAE) HSP 1 Score: 66.2 bits (160), Expect = 1.470e-11 Identity = 31/43 (72.09%), Postives = 36/43 (83.72%), Query Frame = 1 Query: 1 AVSLIKTVVERGPWMEAMGEGLRRATAGDFTGSLLLYSRLAEV 129 AVSL K VVERGPWM+ M LRRATAGD+ G+L+LYSRLAE+ Sbjct: 428 AVSLFKNVVERGPWMDGMQAALRRATAGDYGGALVLYSRLAEI 470 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig70503.16829.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig70503.16829.1 >prot_M-pyrifera_M_contig70503.16829.1 ID=prot_M-pyrifera_M_contig70503.16829.1|Name=mRNA_M-pyrifera_M_contig70503.16829.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bp AVSLIKTVVERGPWMEAMGEGLRRATAGDFTGSLLLYSRLAEVback to top mRNA from alignment at M-pyrifera_M_contig70503:89..217- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig70503.16829.1 ID=mRNA_M-pyrifera_M_contig70503.16829.1|Name=mRNA_M-pyrifera_M_contig70503.16829.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=129bp|location=Sequence derived from alignment at M-pyrifera_M_contig70503:89..217- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig70503:89..217- >mRNA_M-pyrifera_M_contig70503.16829.1 ID=mRNA_M-pyrifera_M_contig70503.16829.1|Name=mRNA_M-pyrifera_M_contig70503.16829.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig70503:89..217- (Macrocystis pyrifera P11B4 male)back to top |