prot_M-pyrifera_M_contig105025.1082.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105025.1082.1 vs. uniprot
Match: A0A6H5JPB8_9PHAE (CCHC-type domain-containing protein n=7 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPB8_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.010e-7 Identity = 30/111 (27.03%), Postives = 57/111 (51.35%), Query Frame = 0 Query: 1 RQAWDALLAWYDPQTTGAKSDLSRRLNSFKMAPGSNPLEEMGRIQDLAAEMRTAGMSVDDHMLYTIFIDALPVEYEVEARNLASRDSIGRDDIIKAVREQHHRLSGNRKKR 111 +QA D L ++P++ A +L + +F M NP E + ++ LA+ + G+ V+ + ++F+ ALP EY+ L S ++ R ++I+ V QH + + R Sbjct: 231 KQALDELDKVHNPESQVATQELLSKFQNFAMPADKNPTESLIAMEQLASRLNERGVRVEASYVLSLFLSALPAEYDHAKLTLQSAPTLDRGEVIRVVGSQHSSIKQGKSHR 341 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105025.1082.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig105025.1082.1 ID=prot_M-pyrifera_M_contig105025.1082.1|Name=mRNA_M-pyrifera_M_contig105025.1082.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=128bpback to top |