mRNA_M-pyrifera_M_contig105025.1082.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig105025.1082.1 vs. uniprot
Match: A0A6H5JPB8_9PHAE (CCHC-type domain-containing protein n=7 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPB8_9PHAE) HSP 1 Score: 59.3 bits (142), Expect = 1.010e-7 Identity = 30/111 (27.03%), Postives = 57/111 (51.35%), Query Frame = 1 Query: 1 RQAWDALLAWYDPQTTGAKSDLSRRLNSFKMAPGSNPLEEMGRIQDLAAEMRTAGMSVDDHMLYTIFIDALPVEYEVEARNLASRDSIGRDDIIKAVREQHHRLSGNRKKR 333 +QA D L ++P++ A +L + +F M NP E + ++ LA+ + G+ V+ + ++F+ ALP EY+ L S ++ R ++I+ V QH + + R Sbjct: 231 KQALDELDKVHNPESQVATQELLSKFQNFAMPADKNPTESLIAMEQLASRLNERGVRVEASYVLSLFLSALPAEYDHAKLTLQSAPTLDRGEVIRVVGSQHSSIKQGKSHR 341 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig105025.1082.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig105025.1082.1 >prot_M-pyrifera_M_contig105025.1082.1 ID=prot_M-pyrifera_M_contig105025.1082.1|Name=mRNA_M-pyrifera_M_contig105025.1082.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=128bp RQAWDALLAWYDPQTTGAKSDLSRRLNSFKMAPGSNPLEEMGRIQDLAAEback to top mRNA from alignment at M-pyrifera_M_contig105025:94..477+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig105025.1082.1 ID=mRNA_M-pyrifera_M_contig105025.1082.1|Name=mRNA_M-pyrifera_M_contig105025.1082.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=384bp|location=Sequence derived from alignment at M-pyrifera_M_contig105025:94..477+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig105025:94..477+ >mRNA_M-pyrifera_M_contig105025.1082.1 ID=mRNA_M-pyrifera_M_contig105025.1082.1|Name=mRNA_M-pyrifera_M_contig105025.1082.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=768bp|location=Sequence derived from alignment at M-pyrifera_M_contig105025:94..477+ (Macrocystis pyrifera P11B4 male)back to top |