prot_M-pyrifera_M_contig104844.1038.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig104844.1038.1 vs. uniprot
Match: A0A8J2WVC9_9STRA (Hypothetical protein n=3 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2WVC9_9STRA) HSP 1 Score: 71.2 bits (173), Expect = 4.800e-12 Identity = 40/107 (37.38%), Postives = 57/107 (53.27%), Query Frame = 0 Query: 11 SRQMLHNASGEPVRQEEIDTDSDSATEAEGDAWRVRKEVQTLVCAEDTDPKEAQFIALWNVFASTYKMYADYVVPRALLAFARAHGREIVRRGLRQALLCHAVVLWE 117 +RQ H +G+P+ + + DS E + + WR+R+ L ED P E F+ LWN + + AD VPRA++AFARAH EI + LR L H LW+ Sbjct: 448 TRQYYHARTGQPIHPRLLQSGYDSDDEVD-EGWRLRRAEVLLDEFEDVTPPEKAFMKLWNRWIFARPIQADRDVPRAVVAFARAHAAEIAGQNLRHNFLLHLFHLWD 553 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig104844.1038.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig104844.1038.1 ID=prot_M-pyrifera_M_contig104844.1038.1|Name=mRNA_M-pyrifera_M_contig104844.1038.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=117bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|