prot_M-pyrifera_M_contig103967.842.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103967.842.1 vs. uniprot
Match: A0A1Y1HXU4_KLENI (Uncharacterized protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HXU4_KLENI) HSP 1 Score: 83.2 bits (204), Expect = 5.230e-15 Identity = 39/94 (41.49%), Postives = 56/94 (59.57%), Query Frame = 0 Query: 104 RCTTSSEPGRWLGILDKTTPCEPPVCSGDRVQSMVTAQSWMGAIYDYVWVPYNCYFHLYSPNDISYCAREAGISWIHVMGDSLSREMEAYLASV 197 RC +PGRWL L C PP CSG+R + V + W G +V+ P+ C +H++S DI+ CA E G+ W+HV+GDS RE+ + L S+ Sbjct: 893 RCVEGDKPGRWLN-LPVAENCRPPFCSGNRSATNVVKE-WNGNDIPWVYAPFGCQYHMFSLGDITTCAGETGVKWVHVVGDSTVREIPSTLFSM 984 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103967.842.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103967.842.1 ID=prot_M-pyrifera_M_contig103967.842.1|Name=mRNA_M-pyrifera_M_contig103967.842.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=202bpback to top |