prot_M-pyrifera_M_contig103822.814.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103822.814.1 vs. uniprot
Match: A0A7Y2IJ16_9ACTN (Uncharacterized protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A7Y2IJ16_9ACTN) HSP 1 Score: 61.6 bits (148), Expect = 2.570e-9 Identity = 36/105 (34.29%), Postives = 57/105 (54.29%), Query Frame = 0 Query: 9 VLSSACGEDEFPPQVKQDAEIYEAALNHLVEVSGVELADNWVDPVVFVEVLDTTEVDLETQVAVIDEMDEAFAIRFVDDLGEAIDIELDDLPVREGTILIAFGPI 113 VL +AC P +DA Y A ++ L++ S ++ D PV++VE + L QV ++ + + +RFVDD GEA+ ++L+ PVR + LI GPI Sbjct: 25 VLVTACSSQPKPETTDRDASAYAAVIDALLQGSPLDQEDPDRLPVIYVEAFAQEGISLTVQVQLVTAYADTYQLRFVDDRGEALLVDLEKQPVRSSSALIGLGPI 129 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103822.814.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103822.814.1 ID=prot_M-pyrifera_M_contig103822.814.1|Name=mRNA_M-pyrifera_M_contig103822.814.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=118bpback to top |