prot_M-pyrifera_M_contig103501.744.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig103501.744.1 vs. uniprot
Match: UPI0004C00D9C (hypothetical protein n=1 Tax=unclassified Streptomyces TaxID=2593676 RepID=UPI0004C00D9C) HSP 1 Score: 54.7 bits (130), Expect = 8.660e-7 Identity = 36/121 (29.75%), Postives = 60/121 (49.59%), Query Frame = 0 Query: 1 VSFDLYFLPRPTGGPFDHTAAAERRRHTDATSNSDLVI--WDRIGHRLEIEMPTMESSPIDG-GRSYADAEVGVELLLTPGEIALSAPHDLAGVTVGDVIDMLRRAAAIVETVTGLVAYDP 118 +S+D+YFL R G P+D A D+ S ++ W+RI + + + +E + + R + + G++L + E+++S P+ G V + AAIVE TGL AYDP Sbjct: 1 MSYDIYFLNRRDGQPWDEVLKALEDEVGDSRPVSAHLLGAWERIVPQAQALLGEVEITEYEQESRDLSHSGTGIDLSVFGDEVSISVPYWHTGDDAAAVFGQVSALAAIVEKETGLTAYDP 121 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig103501.744.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig103501.744.1 ID=prot_M-pyrifera_M_contig103501.744.1|Name=mRNA_M-pyrifera_M_contig103501.744.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=125bpback to top |