prot_M-pyrifera_M_contig100733.165.1 (polypeptide) Macrocystis pyrifera P11B4 male

You are viewing a polypeptide, more information available on the corresponding mRNA page

InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
ZOOM
x 1
POSITION
0
CVNSAPHPLSRLAFASGNYSIFVLERDAAGYMQLRATLYGHKEEVKALSFNPTDRNMLLSGGSDGMLVWDVDGKKLLMTVNVTTRPKDSHESDVECFCWAHEGSTLITGSKDTNVKIWDVARGFTLLETVHGHKSAV20406080100120Expect = 2.3E-5 / Score = 33.8Expect = 1.4E-5 / Score = 34.5Expect = 0.096 / Score = 13.6Expect = 5.6E-7 / Score = 30.2Score = 11.344Score = 13.55Expect = 2.5E-25 / Score = 91.5Score = Score = Score = Score = 20.593Score = SequenceSM00320PF00400PS50082PS50082G3DSA:2.130.10.10PTHR22847PTHR22847:SF650PS00678PS50294SSF50978
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 31..70
e-value: 2.3E-5
score: 33.8
coord: 73..119
e-value: 1.4E-5
score: 34.5
IPR001680WD40 repeatPFAMPF00400WD40coord: 34..67
e-value: 0.096
score: 13.6
coord: 89..119
e-value: 5.6E-7
score: 30.2
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 38..79
score: 11.344
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 87..128
score: 13.55
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3D2.130.10.10coord: 1..137
e-value: 2.5E-25
score: 91.5
NoneNo IPR availablePANTHERPTHR22847WD40 REPEAT PROTEINcoord: 2..137
NoneNo IPR availablePANTHERPTHR22847:SF650coord: 2..137
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 106..120
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 38..137
score: 20.593
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILY50978WD40 repeat-likecoord: 10..137