mRNA_M-pyrifera_M_contig99883.22972.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99883.22972.1 vs. uniprot
Match: A0A3D5DDR0_9GAMM (Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A3D5DDR0_9GAMM) HSP 1 Score: 106 bits (265), Expect = 7.080e-29 Identity = 50/55 (90.91%), Postives = 55/55 (100.00%), Query Frame = 1 Query: 1 DKYGEKMSALLIDPNTNELNANGTMYVDSKGRRVFIDDTLEDGETIAFLVGIAGG 165 +KYG+KMSALLIDP+TN+LNANGTMYVDSKGRRVFI+DTLEDGETIAFLVGIAGG Sbjct: 39 EKYGDKMSALLIDPDTNQLNANGTMYVDSKGRRVFIEDTLEDGETIAFLVGIAGG 93
BLAST of mRNA_M-pyrifera_M_contig99883.22972.1 vs. uniprot
Match: A0A7Y4UB19_9DELT (Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A7Y4UB19_9DELT) HSP 1 Score: 84.7 bits (208), Expect = 3.440e-20 Identity = 39/54 (72.22%), Postives = 45/54 (83.33%), Query Frame = 1 Query: 4 KYGEKMSALLIDPNTNELNANGTMYVDSKGRRVFIDDTLEDGETIAFLVGIAGG 165 KYG M ALLIDP T +LN GT+++DSKGRR+ IDDTLEDGE IAF+VGIAGG Sbjct: 40 KYGPLMEALLIDPETKDLNNKGTLFLDSKGRRICIDDTLEDGEVIAFMVGIAGG 93
BLAST of mRNA_M-pyrifera_M_contig99883.22972.1 vs. uniprot
Match: A0A1Z9ULC2_9GAMM (Uncharacterized protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z9ULC2_9GAMM) HSP 1 Score: 79.3 bits (194), Expect = 4.650e-18 Identity = 36/55 (65.45%), Postives = 43/55 (78.18%), Query Frame = 1 Query: 1 DKYGEKMSALLIDPNTNELNANGTMYVDSKGRRVFIDDTLEDGETIAFLVGIAGG 165 D YG KM A+LIDP+T ELN GTM+VD++G RV + D L DG+TI FLVGIAGG Sbjct: 39 DTYGPKMEAMLIDPDTRELNERGTMFVDARGMRVSMSDALNDGDTITFLVGIAGG 93 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99883.22972.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99883.22972.1 >prot_M-pyrifera_M_contig99883.22972.1 ID=prot_M-pyrifera_M_contig99883.22972.1|Name=mRNA_M-pyrifera_M_contig99883.22972.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=50bp MSALLIDPNTNELNANGTMYVDSKGRRVFIDDTLEDGETIAFLVGIAGG*back to top mRNA from alignment at M-pyrifera_M_contig99883:517..684- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99883.22972.1 ID=mRNA_M-pyrifera_M_contig99883.22972.1|Name=mRNA_M-pyrifera_M_contig99883.22972.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=168bp|location=Sequence derived from alignment at M-pyrifera_M_contig99883:517..684- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99883:517..684- >mRNA_M-pyrifera_M_contig99883.22972.1 ID=mRNA_M-pyrifera_M_contig99883.22972.1|Name=mRNA_M-pyrifera_M_contig99883.22972.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=300bp|location=Sequence derived from alignment at M-pyrifera_M_contig99883:517..684- (Macrocystis pyrifera P11B4 male)back to top |