mRNA_M-pyrifera_M_contig99359.22859.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: A0A8J9VL50_BRALA (DIO3 protein n=1 Tax=Branchiostoma lanceolatum TaxID=7740 RepID=A0A8J9VL50_BRALA) HSP 1 Score: 55.8 bits (133), Expect = 5.500e-8 Identity = 25/36 (69.44%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDG 108 PPFRDA+ D+ L E++ VADFL VYIEEAHPSDG Sbjct: 131 PPFRDALSDFAVLAEDYRNVADFLLVYIEEAHPSDG 166
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: UPI0009E2712A (type I iodothyronine deiodinase-like n=1 Tax=Orbicella faveolata TaxID=48498 RepID=UPI0009E2712A) HSP 1 Score: 53.9 bits (128), Expect = 2.630e-7 Identity = 25/42 (59.52%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWN 126 P FR V+++ + EFS+VADFL VYIEEAHPSDG A + N Sbjct: 122 PVFRTRVDEFLSIAREFSDVADFLAVYIEEAHPSDGWAFKNN 163
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: A0A6P4XYN8_BRABE (Iodothyronine deiodinase n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=A0A6P4XYN8_BRABE) HSP 1 Score: 53.5 bits (127), Expect = 3.820e-7 Identity = 23/36 (63.89%), Postives = 28/36 (77.78%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDG 108 PPFRDA+ D+ L E++ A+FL VYIEEAHPSDG Sbjct: 131 PPFRDALSDFAALAEDYRNAANFLLVYIEEAHPSDG 166
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: A0A6P5JLN1_PHACI (Iodothyronine deiodinase n=2 Tax=Metatheria TaxID=9263 RepID=A0A6P5JLN1_PHACI) HSP 1 Score: 53.5 bits (127), Expect = 4.450e-7 Identity = 26/43 (60.47%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWNS 129 PPF + + + L EEFS VADFL VYI+EAHPSDG A+ NS Sbjct: 176 PPFTNQLPAFSKLVEEFSTVADFLLVYIDEAHPSDGWAVPGNS 218
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: C3ZLK4_BRAFL (Iodothyronine deiodinase n=2 Tax=Branchiostoma floridae TaxID=7739 RepID=C3ZLK4_BRAFL) HSP 1 Score: 53.1 bits (126), Expect = 6.100e-7 Identity = 23/36 (63.89%), Postives = 29/36 (80.56%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDG 108 PPFRDA+ D+ L +++ VA+FL VYIEEAHPSDG Sbjct: 131 PPFRDALSDFAVLAQDYQNVANFLLVYIEEAHPSDG 166
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: A9J434_URSMA (Iodothyronine deiodinase (Fragment) n=2 Tax=Ursidae TaxID=9632 RepID=A9J434_URSMA) HSP 1 Score: 51.6 bits (122), Expect = 8.340e-7 Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWNS 129 PPF + + L EEFS VADFL VYI+EAHPSDG A+ +S Sbjct: 46 PPFTSQLPAFSKLVEEFSSVADFLLVYIDEAHPSDGWAVPGDS 88
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: J7LIG6_SHEEP (Iodothyronine deiodinase (Fragment) n=1 Tax=Ovis aries TaxID=9940 RepID=J7LIG6_SHEEP) HSP 1 Score: 52.0 bits (123), Expect = 8.750e-7 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWNS 129 PPF + + + L EEFS VADFL VYI+EAHPSDG A+ +S Sbjct: 60 PPFTNQLPAFSKLVEEFSSVADFLLVYIDEAHPSDGWAVXGDS 102
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: IOD2_HUMAN (Type II iodothyronine deiodinase n=75 Tax=Eutheria TaxID=9347 RepID=IOD2_HUMAN) HSP 1 Score: 52.4 bits (124), Expect = 1.020e-6 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWNS 129 PPF + ++ L EEFS VADFL VYI+EAHPSDG A+ +S Sbjct: 134 PPFTSQLPAFRKLVEEFSSVADFLLVYIDEAHPSDGWAIPGDS 176
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: A0A2B4SX22_STYPI (Iodothyronine deiodinase n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4SX22_STYPI) HSP 1 Score: 52.4 bits (124), Expect = 1.100e-6 Identity = 24/42 (57.14%), Postives = 31/42 (73.81%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWN 126 P FR V ++ + +EFS+VADFL +Y+EEAHPSDG A E N Sbjct: 174 PVFRARVGEFLSVVQEFSDVADFLTIYVEEAHPSDGWAFENN 215
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Match: A0A340Y1L5_LIPVE (Iodothyronine deiodinase n=4 Tax=Boreoeutheria TaxID=1437010 RepID=A0A340Y1L5_LIPVE) HSP 1 Score: 52.0 bits (123), Expect = 1.370e-6 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 1 PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWNS 129 PPF + + + L EEFS VADFL VYI+EAHPSDG A+ +S Sbjct: 134 PPFTNQLPAFSKLVEEFSSVADFLLVYIDEAHPSDGWAVPGDS 176 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig99359.22859.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig99359.22859.1 >prot_M-pyrifera_M_contig99359.22859.1 ID=prot_M-pyrifera_M_contig99359.22859.1|Name=mRNA_M-pyrifera_M_contig99359.22859.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=43bp PPFRDAVEDWKGLQEEFSEVADFLCVYIEEAHPSDGMAMEWNSback to top mRNA from alignment at M-pyrifera_M_contig99359:457..585+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig99359.22859.1 ID=mRNA_M-pyrifera_M_contig99359.22859.1|Name=mRNA_M-pyrifera_M_contig99359.22859.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=129bp|location=Sequence derived from alignment at M-pyrifera_M_contig99359:457..585+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig99359:457..585+ >mRNA_M-pyrifera_M_contig99359.22859.1 ID=mRNA_M-pyrifera_M_contig99359.22859.1|Name=mRNA_M-pyrifera_M_contig99359.22859.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=258bp|location=Sequence derived from alignment at M-pyrifera_M_contig99359:457..585+ (Macrocystis pyrifera P11B4 male)back to top |