mRNA_M-pyrifera_M_contig9506.21934.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig9506.21934.1 vs. uniprot
Match: D7G5I9_ECTSI (Zeaxanthin epoxidase, chloroplast n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G5I9_ECTSI) HSP 1 Score: 65.5 bits (158), Expect = 2.390e-11 Identity = 30/40 (75.00%), Postives = 36/40 (90.00%), Query Frame = 1 Query: 1 VSMSPFEVDAPGGINSFMTSLMKPALPLIFYMQFMYLYRY 120 V++SPF +DAPGGINSFMTS+MKP LPLIF+ QFMYLY + Sbjct: 477 VTLSPFNMDAPGGINSFMTSVMKPVLPLIFFAQFMYLYSF 516 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig9506.21934.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig9506.21934.1 >prot_M-pyrifera_M_contig9506.21934.1 ID=prot_M-pyrifera_M_contig9506.21934.1|Name=mRNA_M-pyrifera_M_contig9506.21934.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=38bp MSPFEVDAPGGINSFMTSLMKPALPLIFYMQFMYLYRYback to top mRNA from alignment at M-pyrifera_M_contig9506:7640..7759+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig9506.21934.1 ID=mRNA_M-pyrifera_M_contig9506.21934.1|Name=mRNA_M-pyrifera_M_contig9506.21934.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=120bp|location=Sequence derived from alignment at M-pyrifera_M_contig9506:7640..7759+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig9506:7640..7759+ >mRNA_M-pyrifera_M_contig9506.21934.1 ID=mRNA_M-pyrifera_M_contig9506.21934.1|Name=mRNA_M-pyrifera_M_contig9506.21934.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=228bp|location=Sequence derived from alignment at M-pyrifera_M_contig9506:7640..7759+ (Macrocystis pyrifera P11B4 male)back to top |