mRNA_M-pyrifera_M_contig91864.21265.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91864.21265.1 vs. uniprot
Match: K3WHW0_GLOUD (DUF676 domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WHW0_GLOUD) HSP 1 Score: 52.4 bits (124), Expect = 2.300e-6 Identity = 23/60 (38.33%), Postives = 40/60 (66.67%), Query Frame = 1 Query: 1 RMLYVLVHGNNGQPTDWNFLKERLQRIFGISALVMVSTSNSHS-THDGIEIGGLNLAIEI 177 R + VLVHGNNG PTD++ ++ L + +G ++++ + +H+ T G+E+GG LA E+ Sbjct: 24 RHIIVLVHGNNGAPTDFDAIESALVKKYGFDDILIIKSKVNHTQTSLGVEVGGSRLASEV 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91864.21265.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig91864.21265.1 >prot_M-pyrifera_M_contig91864.21265.1 ID=prot_M-pyrifera_M_contig91864.21265.1|Name=mRNA_M-pyrifera_M_contig91864.21265.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=58bp MLYVLVHGNNGQPTDWNFLKERLQRIFGISALVMVSTSNSHSTHDGIEIGback to top mRNA from alignment at M-pyrifera_M_contig91864:350..526- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig91864.21265.1 ID=mRNA_M-pyrifera_M_contig91864.21265.1|Name=mRNA_M-pyrifera_M_contig91864.21265.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=177bp|location=Sequence derived from alignment at M-pyrifera_M_contig91864:350..526- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig91864:350..526- >mRNA_M-pyrifera_M_contig91864.21265.1 ID=mRNA_M-pyrifera_M_contig91864.21265.1|Name=mRNA_M-pyrifera_M_contig91864.21265.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=348bp|location=Sequence derived from alignment at M-pyrifera_M_contig91864:350..526- (Macrocystis pyrifera P11B4 male)back to top |