prot_M-pyrifera_M_contig91864.21265.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91864.21265.1 vs. uniprot
Match: K3WHW0_GLOUD (DUF676 domain-containing protein n=1 Tax=Globisporangium ultimum (strain ATCC 200006 / CBS 805.95 / DAOM BR144) TaxID=431595 RepID=K3WHW0_GLOUD) HSP 1 Score: 50.8 bits (120), Expect = 7.720e-6 Identity = 22/58 (37.93%), Postives = 39/58 (67.24%), Query Frame = 0 Query: 2 LYVLVHGNNGQPTDWNFLKERLQRIFGISALVMVSTSNSHS-THDGIEIGGLNLAIEI 58 + VLVHGNNG PTD++ ++ L + +G ++++ + +H+ T G+E+GG LA E+ Sbjct: 26 IIVLVHGNNGAPTDFDAIESALVKKYGFDDILIIKSKVNHTQTSLGVEVGGSRLASEV 83 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91864.21265.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig91864.21265.1 ID=prot_M-pyrifera_M_contig91864.21265.1|Name=mRNA_M-pyrifera_M_contig91864.21265.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=58bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|