mRNA_M-pyrifera_M_contig91628.21231.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91628.21231.1 vs. uniprot
Match: E0XV40_9GAMM (Uncharacterized protein n=1 Tax=uncultured Chromatiales bacterium HF0200_41F04 TaxID=710740 RepID=E0XV40_9GAMM) HSP 1 Score: 54.3 bits (129), Expect = 6.100e-9 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 1 Query: 1 TSLPGDHSEREPPESISNSEVKLLSADDSVGDPM 102 TSLPGD+SER PP+ ISNSEVK LSADDSVG PM Sbjct: 24 TSLPGDYSERVPPDPISNSEVKPLSADDSVGGPM 57
BLAST of mRNA_M-pyrifera_M_contig91628.21231.1 vs. uniprot
Match: E0Y013_9GAMM (Uncharacterized protein n=1 Tax=uncultured gamma proteobacterium EB000_65A11 TaxID=710972 RepID=E0Y013_9GAMM) HSP 1 Score: 48.5 bits (114), Expect = 1.240e-6 Identity = 26/34 (76.47%), Postives = 28/34 (82.35%), Query Frame = -2 Query: 3 HMGSPTLSSALSSFTSEFEMDSGGSRSLWSPGKL 104 HMG+PTL SALSSFTSEFEM SGGS +L S KL Sbjct: 5 HMGTPTLPSALSSFTSEFEMGSGGSYTLLSSDKL 38
BLAST of mRNA_M-pyrifera_M_contig91628.21231.1 vs. uniprot
Match: E7C375_9GAMM (Uncharacterized protein n=1 Tax=uncultured gamma proteobacterium HF0130_26L16 TaxID=723569 RepID=E7C375_9GAMM) HSP 1 Score: 48.5 bits (114), Expect = 2.810e-6 Identity = 24/32 (75.00%), Postives = 26/32 (81.25%), Query Frame = -2 Query: 3 GSPTLSSALSSFTSEFEMDSGGSRSLWSPGKL 98 G PTLSSAL FTSEF M SGG+R+LW PGKL Sbjct: 26 GDPTLSSALCVFTSEFGMGSGGTRTLWPPGKL 57 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91628.21231.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig91628.21231.1 >prot_M-pyrifera_M_contig91628.21231.1 ID=prot_M-pyrifera_M_contig91628.21231.1|Name=mRNA_M-pyrifera_M_contig91628.21231.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=35bp TSLPGDHSEREPPESISNSEVKLLSADDSVGDPM*back to top mRNA from alignment at M-pyrifera_M_contig91628:323..427+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig91628.21231.1 ID=mRNA_M-pyrifera_M_contig91628.21231.1|Name=mRNA_M-pyrifera_M_contig91628.21231.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=105bp|location=Sequence derived from alignment at M-pyrifera_M_contig91628:323..427+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig91628:323..427+ >mRNA_M-pyrifera_M_contig91628.21231.1 ID=mRNA_M-pyrifera_M_contig91628.21231.1|Name=mRNA_M-pyrifera_M_contig91628.21231.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=210bp|location=Sequence derived from alignment at M-pyrifera_M_contig91628:323..427+ (Macrocystis pyrifera P11B4 male)back to top |