prot_M-pyrifera_M_contig91628.21231.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91628.21231.1 vs. uniprot
Match: E0XV40_9GAMM (Uncharacterized protein n=1 Tax=uncultured Chromatiales bacterium HF0200_41F04 TaxID=710740 RepID=E0XV40_9GAMM) HSP 1 Score: 54.3 bits (129), Expect = 6.100e-9 Identity = 28/34 (82.35%), Postives = 30/34 (88.24%), Query Frame = 0 Query: 1 TSLPGDHSEREPPESISNSEVKLLSADDSVGDPM 34 TSLPGD+SER PP+ ISNSEVK LSADDSVG PM Sbjct: 24 TSLPGDYSERVPPDPISNSEVKPLSADDSVGGPM 57 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91628.21231.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig91628.21231.1 ID=prot_M-pyrifera_M_contig91628.21231.1|Name=mRNA_M-pyrifera_M_contig91628.21231.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=35bpback to top |