mRNA_M-pyrifera_M_contig91417.21185.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91417.21185.1 vs. uniprot
Match: A0A6H5KUW1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUW1_9PHAE) HSP 1 Score: 90.1 bits (222), Expect = 7.090e-20 Identity = 43/56 (76.79%), Postives = 50/56 (89.29%), Query Frame = 1 Query: 1 VTAVAVSPGGEEVALGLRNGDVKLYDLPSLEFRSNLTRFTAPVLGLHYGMKDGGVM 168 VTAVAVSP G+E+A+GLRNGDVKL+ LP L+F+S LTRFTAPVLGL YGMKDG V+ Sbjct: 81 VTAVAVSPAGDELAVGLRNGDVKLHGLPKLDFKSMLTRFTAPVLGLAYGMKDGDVI 136
BLAST of mRNA_M-pyrifera_M_contig91417.21185.1 vs. uniprot
Match: D7G152_ECTSI (Mcl1_mid domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G152_ECTSI) HSP 1 Score: 90.1 bits (222), Expect = 1.090e-19 Identity = 43/56 (76.79%), Postives = 50/56 (89.29%), Query Frame = 1 Query: 1 VTAVAVSPGGEEVALGLRNGDVKLYDLPSLEFRSNLTRFTAPVLGLHYGMKDGGVM 168 VTAVAVSP G+E+A+GLRNGDVKL+ LP L+F+S LTRFTAPVLGL YGMKDG V+ Sbjct: 71 VTAVAVSPAGDELAVGLRNGDVKLHGLPKLDFKSMLTRFTAPVLGLAYGMKDGDVI 126 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91417.21185.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig91417.21185.1 >prot_M-pyrifera_M_contig91417.21185.1 ID=prot_M-pyrifera_M_contig91417.21185.1|Name=mRNA_M-pyrifera_M_contig91417.21185.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bp VTAVAVSPGGEEVALGLRNGDVKLYDLPSLEFRSNLTRFTAPVLGLHYGMback to top mRNA from alignment at M-pyrifera_M_contig91417:266..436+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig91417.21185.1 ID=mRNA_M-pyrifera_M_contig91417.21185.1|Name=mRNA_M-pyrifera_M_contig91417.21185.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=171bp|location=Sequence derived from alignment at M-pyrifera_M_contig91417:266..436+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig91417:266..436+ >mRNA_M-pyrifera_M_contig91417.21185.1 ID=mRNA_M-pyrifera_M_contig91417.21185.1|Name=mRNA_M-pyrifera_M_contig91417.21185.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=342bp|location=Sequence derived from alignment at M-pyrifera_M_contig91417:266..436+ (Macrocystis pyrifera P11B4 male)back to top |