prot_M-pyrifera_M_contig91417.21185.1 (polypeptide) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig91417.21185.1 vs. uniprot
Match: A0A6H5KUW1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUW1_9PHAE) HSP 1 Score: 90.1 bits (222), Expect = 7.090e-20 Identity = 43/56 (76.79%), Postives = 50/56 (89.29%), Query Frame = 0 Query: 1 VTAVAVSPGGEEVALGLRNGDVKLYDLPSLEFRSNLTRFTAPVLGLHYGMKDGGVM 56 VTAVAVSP G+E+A+GLRNGDVKL+ LP L+F+S LTRFTAPVLGL YGMKDG V+ Sbjct: 81 VTAVAVSPAGDELAVGLRNGDVKLHGLPKLDFKSMLTRFTAPVLGLAYGMKDGDVI 136
BLAST of mRNA_M-pyrifera_M_contig91417.21185.1 vs. uniprot
Match: D7G152_ECTSI (Mcl1_mid domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G152_ECTSI) HSP 1 Score: 90.1 bits (222), Expect = 1.090e-19 Identity = 43/56 (76.79%), Postives = 50/56 (89.29%), Query Frame = 0 Query: 1 VTAVAVSPGGEEVALGLRNGDVKLYDLPSLEFRSNLTRFTAPVLGLHYGMKDGGVM 56 VTAVAVSP G+E+A+GLRNGDVKL+ LP L+F+S LTRFTAPVLGL YGMKDG V+ Sbjct: 71 VTAVAVSPAGDELAVGLRNGDVKLHGLPKLDFKSMLTRFTAPVLGLAYGMKDGDVI 126 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig91417.21185.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Macrocystis pyrifera male
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_M-pyrifera_M_contig91417.21185.1 ID=prot_M-pyrifera_M_contig91417.21185.1|Name=mRNA_M-pyrifera_M_contig91417.21185.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=57bpback to top |