mRNA_M-pyrifera_M_contig90880.21067.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90880.21067.1 vs. uniprot
Match: D7FZG5_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZG5_ECTSI) HSP 1 Score: 102 bits (254), Expect = 5.970e-25 Identity = 50/57 (87.72%), Postives = 52/57 (91.23%), Query Frame = 1 Query: 1 QYRGMKTSTDILSFPMHDMSDNPGVLPKVKFVAEMDLGDMFISLAYVDRQIARDREE 171 QYRGM TSTDILSFP HDMS +PGVLPKV+F AEMDLGDMFISLAYVDRQI RDREE Sbjct: 156 QYRGMSTSTDILSFPNHDMSGSPGVLPKVRFPAEMDLGDMFISLAYVDRQIKRDREE 212
BLAST of mRNA_M-pyrifera_M_contig90880.21067.1 vs. uniprot
Match: A0A7S2RF28_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2RF28_9STRA) HSP 1 Score: 58.5 bits (140), Expect = 1.310e-8 Identity = 28/58 (48.28%), Postives = 39/58 (67.24%), Query Frame = 1 Query: 1 QYRGMKTSTDILSFPMHDMSDNPGVLPKVKFVAEMDLGDMFISLAYVDRQIARDREEA 174 +YRGM+ STDILSFP +D P LP+++ +M+LGDM +S+ YV R RD +A Sbjct: 115 RYRGMRKSTDILSFPFYDQLRAPDPLPEMQCEDDMNLGDMIVSVPYVARACKRDHRDA 172
BLAST of mRNA_M-pyrifera_M_contig90880.21067.1 vs. uniprot
Match: F2UMB9_SALR5 (Uncharacterized protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2UMB9_SALR5) HSP 1 Score: 57.0 bits (136), Expect = 2.140e-8 Identity = 27/50 (54.00%), Postives = 36/50 (72.00%), Query Frame = 1 Query: 1 QYRGMKTSTDILSFPMHDMSDNPGVLPKVKFVAEMDLGDMFISLAYVDRQ 150 QYRG+ STD+LSFP H+++ PG LP V+F E DLGD+F+SL + Q Sbjct: 59 QYRGVGASTDVLSFPFHEVT-TPGTLPPVEFEDEKDLGDIFLSLDTIQAQ 107
BLAST of mRNA_M-pyrifera_M_contig90880.21067.1 vs. uniprot
Match: A0A4D9DAX9_9STRA (Uncharacterized protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9DAX9_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 2.320e-5 Identity = 27/58 (46.55%), Postives = 36/58 (62.07%), Query Frame = 1 Query: 1 QYRGMKTSTDILSFPMHDMSDNPGVLPKVKFVAE---MDLGDMFISLAYVDRQIARDR 165 +YRG +T+TDILSFP H+ + PGV + DLGDM +S+ YV RQ RD+ Sbjct: 127 RYRGKRTATDILSFPFHEY-EAPGVPTSESWALTGEVKDLGDMIVSVPYVQRQCQRDQ 183
BLAST of mRNA_M-pyrifera_M_contig90880.21067.1 vs. uniprot
Match: W7UC15_9STRA (Rrna maturation factor n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7UC15_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 2.410e-5 Identity = 26/60 (43.33%), Postives = 37/60 (61.67%), Query Frame = 1 Query: 1 QYRGMKTSTDILSFPMHDMSDNPGVLPKVKFVAE---MDLGDMFISLAYVDRQIARDREE 171 +YRG +T+TDILSFP H+ + PG+ + DLGDM +S+ YV RQ RD+ + Sbjct: 263 RYRGKRTATDILSFPFHEY-EAPGIPTSESWALTGEVKDLGDMIVSVPYVQRQCQRDQAD 321 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90880.21067.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90880.21067.1 >prot_M-pyrifera_M_contig90880.21067.1 ID=prot_M-pyrifera_M_contig90880.21067.1|Name=mRNA_M-pyrifera_M_contig90880.21067.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=59bp MKTSTDILSFPMHDMSDNPGVLPKVKFVAEMDLGDMFISLAYVDRQIARDback to top mRNA from alignment at M-pyrifera_M_contig90880:191..784+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90880.21067.1 ID=mRNA_M-pyrifera_M_contig90880.21067.1|Name=mRNA_M-pyrifera_M_contig90880.21067.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=594bp|location=Sequence derived from alignment at M-pyrifera_M_contig90880:191..784+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90880:191..784+ >mRNA_M-pyrifera_M_contig90880.21067.1 ID=mRNA_M-pyrifera_M_contig90880.21067.1|Name=mRNA_M-pyrifera_M_contig90880.21067.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=354bp|location=Sequence derived from alignment at M-pyrifera_M_contig90880:191..784+ (Macrocystis pyrifera P11B4 male)back to top |