mRNA_M-pyrifera_M_contig90765.21038.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig90765.21038.1 vs. uniprot
Match: A0A2E1KKX6_9PLAN (Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E1KKX6_9PLAN) HSP 1 Score: 53.1 bits (126), Expect = 5.010e-5 Identity = 32/107 (29.91%), Postives = 48/107 (44.86%), Query Frame = 1 Query: 40 LGGELWHYGGAS---HQNAQARLVYGFIPWIVRADASLIWANYKGDLRGNGWTLHYAMPLDPDGRKHR-------DTRGPVIPSVRAVAVREGIDDRKYIETLRYYA 330 LG LW YG + A R +G W + +W G RG W+ +D +H+ + G +IP+ R A+REGIDD +Y+ TL+ +A Sbjct: 808 LGKXLWSYGXXXXXXYTTADLRHYFGRYLWKSGLKGASLWCYNHGRFRGRFWSYIDRTQVDFSPTEHKLMFSYVWEEDGEIIPTARWEAIREGIDDYRYLRTLKQFA 914 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig90765.21038.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig90765.21038.1 >prot_M-pyrifera_M_contig90765.21038.1 ID=prot_M-pyrifera_M_contig90765.21038.1|Name=mRNA_M-pyrifera_M_contig90765.21038.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=171bp NTLSPAAARLQHRLGGELWHYGGASHQNAQARLVYGFIPWIVRADASLIWback to top mRNA from alignment at M-pyrifera_M_contig90765:212..724+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig90765.21038.1 ID=mRNA_M-pyrifera_M_contig90765.21038.1|Name=mRNA_M-pyrifera_M_contig90765.21038.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=513bp|location=Sequence derived from alignment at M-pyrifera_M_contig90765:212..724+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig90765:212..724+ >mRNA_M-pyrifera_M_contig90765.21038.1 ID=mRNA_M-pyrifera_M_contig90765.21038.1|Name=mRNA_M-pyrifera_M_contig90765.21038.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=1026bp|location=Sequence derived from alignment at M-pyrifera_M_contig90765:212..724+ (Macrocystis pyrifera P11B4 male)back to top |