mRNA_M-pyrifera_M_contig89203.20677.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig89203.20677.1 vs. uniprot
Match: F2TZB6_SALR5 (JmjC domain-containing protein n=1 Tax=Salpingoeca rosetta (strain ATCC 50818 / BSB-021) TaxID=946362 RepID=F2TZB6_SALR5) HSP 1 Score: 67.0 bits (162), Expect = 1.730e-10 Identity = 45/138 (32.61%), Postives = 65/138 (47.10%), Query Frame = 1 Query: 1 VRAGLVPYASTYAGAEMNATTMDLGDYITSYLLNPNPNP-----------TLTPPLYVFDNEVLTKSFVVANSLPIPSFNTSIRQFI-----IGPKDSGAMPHIHDGAWNILFLGRKLWVITPPSCAEFALLPASEWF 366 V VPYASTY + + TM L ++ ++ N + T +YVFD VL + + +S+ +P +S Q + +GP SGA PH H A N+L GRK W + PP A F ++ A WF Sbjct: 382 VSVAAVPYASTYGHSTTH--TMPLRTFVQQHMGYSNNHHQXXXXQAQDCRTTDTCMYVFDGSVLHRHPEMLHSIGLPFVVSSTEQLVLAQLMVGPTGSGAPPHFHGQAINVLVQGRKQWQLFPPQHAFFHMVTAHAWF 517 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig89203.20677.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig89203.20677.1 >prot_M-pyrifera_M_contig89203.20677.1 ID=prot_M-pyrifera_M_contig89203.20677.1|Name=mRNA_M-pyrifera_M_contig89203.20677.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=122bp VRAGLVPYASTYAGAEMNATTMDLGDYITSYLLNPNPNPTLTPPLYVFDNback to top mRNA from alignment at M-pyrifera_M_contig89203:5..370- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig89203.20677.1 ID=mRNA_M-pyrifera_M_contig89203.20677.1|Name=mRNA_M-pyrifera_M_contig89203.20677.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=366bp|location=Sequence derived from alignment at M-pyrifera_M_contig89203:5..370- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig89203:5..370- >mRNA_M-pyrifera_M_contig89203.20677.1 ID=mRNA_M-pyrifera_M_contig89203.20677.1|Name=mRNA_M-pyrifera_M_contig89203.20677.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=732bp|location=Sequence derived from alignment at M-pyrifera_M_contig89203:5..370- (Macrocystis pyrifera P11B4 male)back to top |