mRNA_M-pyrifera_M_contig84957.19800.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84957.19800.1 vs. uniprot
Match: A0A061S375_9CHLO (Light-gated proton channel rhodopsin n=3 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061S375_9CHLO) HSP 1 Score: 50.1 bits (118), Expect = 7.680e-5 Identity = 30/79 (37.97%), Postives = 44/79 (55.70%), Query Frame = 1 Query: 1 VYVDDGEVSRRFFPALRYLGWLVTCPILVAHMHGLPIGMKHKDPRRTLSALVVNQVMTCFGVASVLF-GGTARIVLFVI 234 VY G V+ P LRY+ WL+TCP+++ H+ L G+ + RT+ L +Q CFGV + L G +I+ FVI Sbjct: 102 VYSVFGPVT----PWLRYIEWLLTCPVILIHLSNLT-GLDEEYSARTMHLLTADQGTICFGVTAALSPNGWIKILCFVI 175 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84957.19800.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84957.19800.1 >prot_M-pyrifera_M_contig84957.19800.1 ID=prot_M-pyrifera_M_contig84957.19800.1|Name=mRNA_M-pyrifera_M_contig84957.19800.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=102bp VYVDDGEVSRRFFPALRYLGWLVTCPILVAHMHGLPIGMKHKDPRRTLSAback to top mRNA from alignment at M-pyrifera_M_contig84957:15..320- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84957.19800.1 ID=mRNA_M-pyrifera_M_contig84957.19800.1|Name=mRNA_M-pyrifera_M_contig84957.19800.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=306bp|location=Sequence derived from alignment at M-pyrifera_M_contig84957:15..320- (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84957:15..320- >mRNA_M-pyrifera_M_contig84957.19800.1 ID=mRNA_M-pyrifera_M_contig84957.19800.1|Name=mRNA_M-pyrifera_M_contig84957.19800.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=612bp|location=Sequence derived from alignment at M-pyrifera_M_contig84957:15..320- (Macrocystis pyrifera P11B4 male)back to top |