mRNA_M-pyrifera_M_contig84645.19733.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig84645.19733.1 vs. uniprot
Match: A0A1Q9CUE9_SYMMI (Golgi reassembly-stacking protein 2 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9CUE9_SYMMI) HSP 1 Score: 51.6 bits (122), Expect = 5.810e-6 Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 1 Query: 34 GHRVLEVQPKSPASECGLVPYLDFVVDVDGEHLDGGSRSLAAVMRGSKNKEVSL 195 G R+ +V P SPA+E GL + DF+V++DG H+D + A+ ++ ++N+ L Sbjct: 55 GFRIFKVNPGSPAAEAGLEVFFDFIVEIDGVHMDADQATFASAIQEAENQRTKL 108
BLAST of mRNA_M-pyrifera_M_contig84645.19733.1 vs. uniprot
Match: A0A812LF07_SYMMI (GORASP2 protein n=4 Tax=Symbiodinium TaxID=2949 RepID=A0A812LF07_SYMMI) HSP 1 Score: 51.6 bits (122), Expect = 5.930e-6 Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 1 Query: 34 GHRVLEVQPKSPASECGLVPYLDFVVDVDGEHLDGGSRSLAAVMRGSKNKEVSL 195 G R+ +V P SPA+E GL + DF+V++DG H+D + A+ ++ ++N+ L Sbjct: 56 GFRIFKVNPGSPAAEAGLEVFFDFIVEIDGVHMDADQATFASAIQEAENQRTKL 109
BLAST of mRNA_M-pyrifera_M_contig84645.19733.1 vs. uniprot
Match: A0A812XRB1_9DINO (GORASP2 protein n=1 Tax=Symbiodinium sp. CCMP2592 TaxID=631055 RepID=A0A812XRB1_9DINO) HSP 1 Score: 51.6 bits (122), Expect = 5.940e-6 Identity = 20/54 (37.04%), Postives = 35/54 (64.81%), Query Frame = 1 Query: 34 GHRVLEVQPKSPASECGLVPYLDFVVDVDGEHLDGGSRSLAAVMRGSKNKEVSL 195 G R+ +V P SPA+E GL + DF+V++DG H+D + A+ ++ ++N+ L Sbjct: 41 GFRIFKVNPGSPAAEAGLEVFFDFIVEIDGVHMDADQATFASAIQEAENQRTKL 94
BLAST of mRNA_M-pyrifera_M_contig84645.19733.1 vs. uniprot
Match: B7GDY6_PHATC (Predicted protein n=2 Tax=Phaeodactylum tricornutum TaxID=2850 RepID=B7GDY6_PHATC) HSP 1 Score: 50.4 bits (119), Expect = 1.510e-5 Identity = 29/67 (43.28%), Postives = 38/67 (56.72%), Query Frame = 1 Query: 28 TWGHRVLEVQPKSPASECGLVPYLDFVVDVDGEHLDGGSRSLA-----------AVMRGSKNKEVSL 195 T G+RVL VQP SPAS+ GLV +LDF+V G L G LA A+++ +NKE+ L Sbjct: 24 TLGYRVLGVQPDSPASQAGLVSFLDFLVGAQGRMLLGSGEDLADGEEYDDIDLPALLKEYQNKELEL 90
BLAST of mRNA_M-pyrifera_M_contig84645.19733.1 vs. uniprot
Match: A0A812QLN9_SYMPI (GORASP2 protein n=1 Tax=Symbiodinium pilosum TaxID=2952 RepID=A0A812QLN9_SYMPI) HSP 1 Score: 49.3 bits (116), Expect = 3.860e-5 Identity = 19/54 (35.19%), Postives = 33/54 (61.11%), Query Frame = 1 Query: 34 GHRVLEVQPKSPASECGLVPYLDFVVDVDGEHLDGGSRSLAAVMRGSKNKEVSL 195 G R+ +V P SPA+E GL + DF++++DG H+D + A ++ ++N L Sbjct: 11 GFRIFKVNPGSPAAEAGLEVFFDFILEIDGVHMDADQATFATAIQEAENHRTKL 64 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig84645.19733.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig84645.19733.1 >prot_M-pyrifera_M_contig84645.19733.1 ID=prot_M-pyrifera_M_contig84645.19733.1|Name=mRNA_M-pyrifera_M_contig84645.19733.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=67bp MDVMGREDVTWGHRVLEVQPKSPASECGLVPYLDFVVDVDGEHLDGGSRSback to top mRNA from alignment at M-pyrifera_M_contig84645:675..875+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig84645.19733.1 ID=mRNA_M-pyrifera_M_contig84645.19733.1|Name=mRNA_M-pyrifera_M_contig84645.19733.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=201bp|location=Sequence derived from alignment at M-pyrifera_M_contig84645:675..875+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig84645:675..875+ >mRNA_M-pyrifera_M_contig84645.19733.1 ID=mRNA_M-pyrifera_M_contig84645.19733.1|Name=mRNA_M-pyrifera_M_contig84645.19733.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=402bp|location=Sequence derived from alignment at M-pyrifera_M_contig84645:675..875+ (Macrocystis pyrifera P11B4 male)back to top |