mRNA_M-pyrifera_M_contig8368.19544.1 (mRNA) Macrocystis pyrifera P11B4 male
Overview
Homology
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A6H5L0V1_9PHAE (UBC core domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L0V1_9PHAE) HSP 1 Score: 80.1 bits (196), Expect = 1.300e-16 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: D8LQX5_ECTSI (UBC core domain-containing protein (Fragment) n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQX5_ECTSI) HSP 1 Score: 80.1 bits (196), Expect = 1.460e-16 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A3R7D664_9STRA (Conserved oligomeric Golgi complex subunit 8 n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A3R7D664_9STRA) HSP 1 Score: 81.6 bits (200), Expect = 1.630e-15 Identity = 41/61 (67.21%), Postives = 42/61 (68.85%), Query Frame = 1 Query: 202 SAVRAYF*GQVSPTGGLL*EGSRLDTMALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 SA YF PT L S TMALKRINKEL DLGKDPPANCSAGPV DDL+HWQA Sbjct: 10 SAKNCYFSFSQRPTKSLPSSSSIARTMALKRINKELLDLGKDPPANCSAGPVGDDLFHWQA 70
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A2R5GJC5_9STRA (Ubiquitin-conjugating enzyme E2 E2 n=1 Tax=Hondaea fermentalgiana TaxID=2315210 RepID=A0A2R5GJC5_9STRA) HSP 1 Score: 75.9 bits (185), Expect = 6.170e-15 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MA+KRINKELQDLGKDPPANCSAGPV DDL+HWQA Sbjct: 1 MAMKRINKELQDLGKDPPANCSAGPVNDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A835ZQ60_9STRA (Ubiquitin-conjugating enzyme e2-16kda, ubiquitin protein ligase n=2 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZQ60_9STRA) HSP 1 Score: 75.5 bits (184), Expect = 8.710e-15 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLGKDPPANCSAGP+ DDL+HWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPIGDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A0P1A4M0_PLAHL (Ubiquitin-conjugating enzyme e2-16 kDa n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1A4M0_PLAHL) HSP 1 Score: 74.7 bits (182), Expect = 9.260e-15 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLG+DPPANCSAGPV DDL+HWQA Sbjct: 1 MALKRINKELQDLGRDPPANCSAGPVGDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: W7TCU7_9STRA (Ubiquitin-conjugating enzyme n=1 Tax=Nannochloropsis gaditana TaxID=72520 RepID=W7TCU7_9STRA) HSP 1 Score: 74.7 bits (182), Expect = 1.130e-14 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLG+DPPANCSAGPV DDL+HWQA Sbjct: 1 MALKRINKELQDLGRDPPANCSAGPVGDDLFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A7S2ZCR1_9RHOD (Hypothetical protein n=5 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S2ZCR1_9RHOD) HSP 1 Score: 75.9 bits (185), Expect = 1.200e-14 Identity = 33/35 (94.29%), Postives = 33/35 (94.29%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLGKDPPANCSAGPV DD YHWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPVGDDFYHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: A0A0G4EH01_VITBC (UBC core domain-containing protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EH01_VITBC) HSP 1 Score: 74.7 bits (182), Expect = 1.730e-14 Identity = 31/35 (88.57%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLGKDPPANCSAGP+ DD++HWQA Sbjct: 1 MALKRINKELQDLGKDPPANCSAGPIGDDMFHWQA 35
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Match: F0Y5R5_AURAN (Ubiquitin-conjugating enzyme n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0Y5R5_AURAN) HSP 1 Score: 74.7 bits (182), Expect = 1.990e-14 Identity = 32/35 (91.43%), Postives = 34/35 (97.14%), Query Frame = 1 Query: 280 MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQA 384 MALKRINKELQDLG+DPPANCSAGPV DDL+HWQA Sbjct: 1 MALKRINKELQDLGRDPPANCSAGPVGDDLFHWQA 35 The following BLAST results are available for this feature:
BLAST of mRNA_M-pyrifera_M_contig8368.19544.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Macrocystis pyrifera male vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_M-pyrifera_M_contig8368.19544.1 >prot_M-pyrifera_M_contig8368.19544.1 ID=prot_M-pyrifera_M_contig8368.19544.1|Name=mRNA_M-pyrifera_M_contig8368.19544.1|organism=Macrocystis pyrifera P11B4 male|type=polypeptide|length=35bp MALKRINKELQDLGKDPPANCSAGPVTDDLYHWQAback to top mRNA from alignment at M-pyrifera_M_contig8368:6832..7215+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_M-pyrifera_M_contig8368.19544.1 ID=mRNA_M-pyrifera_M_contig8368.19544.1|Name=mRNA_M-pyrifera_M_contig8368.19544.1|organism=Macrocystis pyrifera P11B4 male|type=mRNA|length=384bp|location=Sequence derived from alignment at M-pyrifera_M_contig8368:6832..7215+ (Macrocystis pyrifera P11B4 male)back to top Coding sequence (CDS) from alignment at M-pyrifera_M_contig8368:6832..7215+ >mRNA_M-pyrifera_M_contig8368.19544.1 ID=mRNA_M-pyrifera_M_contig8368.19544.1|Name=mRNA_M-pyrifera_M_contig8368.19544.1|organism=Macrocystis pyrifera P11B4 male|type=CDS|length=210bp|location=Sequence derived from alignment at M-pyrifera_M_contig8368:6832..7215+ (Macrocystis pyrifera P11B4 male)back to top |